Comparing SMc04042 FitnessBrowser__Smeli:SMc04042 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
46% identity, 86% coverage: 34:256/259 of query aligns to 26:258/259 of 5eq8A
5eq9B Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ (see paper)
46% identity, 86% coverage: 34:256/259 of query aligns to 27:259/260 of 5eq9B
5t3jA Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min (see paper)
47% identity, 84% coverage: 39:256/259 of query aligns to 31:256/257 of 5t3jA
Sites not aligning to the query:
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
43% identity, 96% coverage: 9:256/259 of query aligns to 91:344/346 of Q6NPM8
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
30% identity, 95% coverage: 11:256/259 of query aligns to 7:255/255 of 5yhtA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 95% coverage: 11:256/259 of query aligns to 10:258/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
30% identity, 95% coverage: 11:256/259 of query aligns to 8:256/256 of 5zonA
2p3nA Thermotoga maritima impase tm1415 (see paper)
33% identity, 79% coverage: 30:234/259 of query aligns to 28:225/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 79% coverage: 30:234/259 of query aligns to 28:225/256 of O33832
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
33% identity, 83% coverage: 34:249/259 of query aligns to 38:256/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 83% coverage: 34:249/259 of query aligns to 34:252/267 of P0ADG4
Sites not aligning to the query:
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
32% identity, 93% coverage: 19:258/259 of query aligns to 22:265/266 of Q9K4B1
6tqoT Rrn anti-termination complex (see paper)
33% identity, 82% coverage: 38:249/259 of query aligns to 30:244/255 of 6tqoT
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
34% identity, 83% coverage: 34:249/259 of query aligns to 34:252/262 of 2qflA
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
32% identity, 86% coverage: 33:256/259 of query aligns to 32:255/258 of 3lv0A
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
32% identity, 85% coverage: 36:256/259 of query aligns to 23:237/238 of 3luzA
Sites not aligning to the query:
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
31% identity, 85% coverage: 38:256/259 of query aligns to 26:233/234 of 3luzB
Sites not aligning to the query:
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 85% coverage: 34:252/259 of query aligns to 38:266/271 of Q9M8S8
5dw8A Crystal structure of 2'amp bound saimpase-ii
28% identity, 87% coverage: 26:250/259 of query aligns to 15:240/260 of 5dw8A
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
28% identity, 85% coverage: 38:256/259 of query aligns to 34:258/259 of 2cziA
>SMc04042 FitnessBrowser__Smeli:SMc04042
MLPDRTFFDRLADAAKAETMPRFRVGTSVLNKLEGGFDPVTEADRSAEASIRALIESSFP
EHGILGEEHGNIGLDRELVWVIDPIDGTRAFISGLPVWGTLIGLYRNGKAVMGLMDQPFT
GERFFADGEKALYRGPDGERVLATRPCHALSDAVLFTTSPHLYTGELKERFEALQEKVRL
FRYGCDCYAFALLAAGHVDLVVECGLKPYDVGGLIPLIEQAGGIITDWQGGPAEMGGEII
AAGSRELHAQALEALKGRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory