Comparing SMc04127 FitnessBrowser__Smeli:SMc04127 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
36% identity, 98% coverage: 6:506/511 of query aligns to 5:494/501 of P04983
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 42% coverage: 6:220/511 of query aligns to 4:217/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 42% coverage: 6:220/511 of query aligns to 4:217/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 42% coverage: 6:220/511 of query aligns to 4:217/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 42% coverage: 6:220/511 of query aligns to 4:217/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 43% coverage: 6:227/511 of query aligns to 2:227/343 of P30750
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 41% coverage: 11:221/511 of query aligns to 10:230/254 of 1g6hA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 43% coverage: 6:227/511 of query aligns to 3:228/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 43% coverage: 6:227/511 of query aligns to 3:228/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 43% coverage: 6:227/511 of query aligns to 3:228/344 of 3tuiC
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 41% coverage: 11:221/511 of query aligns to 10:230/253 of 1g9xB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 43% coverage: 6:227/511 of query aligns to 2:222/240 of 4ymuJ
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 43% coverage: 6:227/511 of query aligns to 4:228/615 of 5lilA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 42% coverage: 6:220/511 of query aligns to 3:215/241 of 4u00A
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 43% coverage: 6:227/511 of query aligns to 4:228/592 of 5lj7A
7t55A Cryo-em structure of pcat1 in the inward-facing wide conformation under atp turnover condition (see paper)
33% identity, 43% coverage: 6:227/511 of query aligns to 479:699/715 of 7t55A
Sites not aligning to the query:
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
27% identity, 43% coverage: 1:220/511 of query aligns to 2:218/240 of 1ji0A
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 43% coverage: 1:221/511 of query aligns to 1:225/233 of P75957
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 42% coverage: 6:220/511 of query aligns to 5:222/648 of P75831
7arlD Lolcde in complex with lipoprotein and adp (see paper)
30% identity, 39% coverage: 23:221/511 of query aligns to 24:222/222 of 7arlD
>SMc04127 FitnessBrowser__Smeli:SMc04127
MNNIAIELRGIDKSFGLVHANRNINLRVRKGTIHGIIGENGAGKSTLMSILYGFYQADNG
EILVDGKPVSIRDPNAAISVGIGMVHQHFMLVENFTVLENVMLGAEDSQILNKGIAKARQ
ELKRLEKEYALEVNPDALIEELPVGLQQRVEILKALYRRADILILDEPTGVLTPAEADHL
FRILGQLKAQGKTIILITHKLREIMAITDEVSVMRRGEMVATRTTRETSVEELAELMVGR
RVLLRVEKGESNPGDVKLAVQGLTVKDSRGVTMVDNVSFDVRAGEIVGIAGVAGNGQSEL
LEAIAGIRKAASGTVLLNGRPVDVTGNADAAELRGRGLAHVPEDRHHVGLVLKFEECENA
ILGYHHDPRFANGMFLNIDAIRKDAEEKIAKYDIRPPNARLRTANFSGGNQQKVVLAREM
ERDPDVLIIGQPTRGVDVGAIEFIHKRIIEMRDQGKAVLLVSVELDEIRSLSDRILVMFA
GRVVGERSPEATEGELGLLMAGVEGRKEAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory