SitesBLAST
Comparing SMc04129 FitnessBrowser__Smeli:SMc04129 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
33% identity, 48% coverage: 1:209/433 of query aligns to 3:206/347 of 3q2kC
- active site: K100 (= K102), H188 (= H190)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ N15), K100 (= K102), W159 (= W159), T160 (= T163), R161 (= R164), Y165 (≠ D168), N184 (≠ H186), Q185 (≠ K187), H188 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G14), R17 (≠ N15), I18 (≠ R16), D40 (= D40), T41 (= T41), A76 (≠ C78), T77 (= T79), S79 (≠ D81), H82 (= H84), Q85 (≠ I87), E99 (= E101), K100 (= K102), Q128 (≠ N130), W171 (= W173), R172 (≠ H174)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
33% identity, 47% coverage: 5:209/433 of query aligns to 2:201/322 of 3q2kK
- active site: K95 (= K102), H183 (= H190)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ N15), K95 (= K102), T155 (= T163), R156 (= R164), Y160 (≠ D168), N179 (≠ H186), Q180 (≠ K187), H183 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G12), G11 (= G14), R12 (≠ N15), I13 (≠ R16), D35 (= D40), T36 (= T41), T72 (= T79), P73 (= P80), S74 (≠ D81), L76 (≠ T83), H77 (= H84), E94 (= E101), K95 (= K102), Q123 (≠ N130), W166 (= W173), R167 (≠ H174), H183 (= H190)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
3e18A Crystal structure of NAD-binding protein from listeria innocua
31% identity, 38% coverage: 44:208/433 of query aligns to 36:196/348 of 3e18A
- active site: K94 (= K102), H178 (= H190)
- binding nicotinamide-adenine-dinucleotide: I36 (≠ L44), K40 (≠ R48), A70 (≠ C78), T71 (= T79), P72 (= P80), N73 (≠ D81), H76 (= H84), E93 (= E101), K94 (= K102), N122 (= N130), W161 (= W173), R162 (≠ H174), H178 (= H190)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
28% identity, 43% coverage: 39:224/433 of query aligns to 28:216/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K102), R150 (= R171), W157 (= W173), F160 (≠ Y176), D173 (≠ H186), H177 (= H190)
- binding nicotinamide-adenine-dinucleotide: D51 (≠ N62), Y52 (≠ V63), C67 (= C78), T68 (= T79), P69 (= P80), H73 (= H84), E90 (= E101), K91 (= K102), P92 (= P103), Q119 (≠ N130), V159 (≠ A175), F160 (≠ Y176), Q166 (≠ H179)
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
26% identity, 47% coverage: 7:209/433 of query aligns to 4:195/336 of 3ec7A
- active site: K97 (= K102), H176 (= H190)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M12 (≠ N15), I13 (≠ R16), D35 (= D40), I36 (≠ T41), R40 (= R45), T73 (≠ C78), A74 (≠ T79), S75 (≠ P80), N76 (≠ D81), H79 (= H84), E96 (= E101), K97 (= K102), M126 (≠ N130)
Sites not aligning to the query:
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
28% identity, 47% coverage: 7:209/433 of query aligns to 4:195/337 of 3nt5A
- active site: K97 (= K102), H176 (= H190)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K102), H155 (≠ Y160), H176 (= H190)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), G11 (= G14), A12 (≠ N15), I13 (≠ R16), D35 (= D40), V36 (≠ T41), S74 (≠ T79), W75 (≠ P80), G76 (≠ D81), E96 (= E101), K97 (= K102)
Sites not aligning to the query:
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
28% identity, 47% coverage: 7:209/433 of query aligns to 4:195/337 of 3nt4A
- active site: K97 (= K102), H176 (= H190)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ Y160), H176 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G14), A12 (≠ N15), I13 (≠ R16), D35 (= D40), V36 (≠ T41), S74 (≠ T79), W75 (≠ P80), G76 (≠ D81), E96 (= E101), K97 (= K102), H176 (= H190)
Sites not aligning to the query:
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
28% identity, 47% coverage: 7:209/433 of query aligns to 4:195/337 of 3nt2B
- active site: K97 (= K102), H176 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G12), G11 (= G14), A12 (≠ N15), D35 (= D40), V36 (≠ T41), S74 (≠ T79), W75 (≠ P80), A78 (≠ T83), K97 (= K102)
Sites not aligning to the query:
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
28% identity, 47% coverage: 7:209/433 of query aligns to 4:195/337 of 3nt2A
- active site: K97 (= K102), H176 (= H190)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), G11 (= G14), A12 (≠ N15), I13 (≠ R16), D35 (= D40), V36 (≠ T41), S74 (≠ T79), W75 (≠ P80), G76 (≠ D81), A78 (≠ T83), H79 (= H84), E96 (= E101), K97 (= K102), H176 (= H190)
Sites not aligning to the query:
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
28% identity, 47% coverage: 7:209/433 of query aligns to 4:195/337 of 4l8vA
Sites not aligning to the query:
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
31% identity, 48% coverage: 1:209/433 of query aligns to 7:210/345 of 3q2iA
- active site: K104 (= K102), H192 (= H190)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (= K102), N133 (≠ Y131), T164 (= T163), R165 (= R164), Y169 (≠ D168), N188 (≠ H186), Q189 (≠ K187), H192 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C19 (≠ T13), G20 (= G14), R21 (≠ N15), I22 (≠ R16), D44 (≠ A37), I45 (= I38), T81 (= T79), P82 (= P80), S83 (≠ D81), H86 (= H84), E103 (= E101), K104 (= K102), Q132 (≠ N130), W175 (= W173), R176 (≠ H174), H192 (= H190)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 247, 248
7xreC Crystal structure of dgpa
27% identity, 45% coverage: 32:224/433 of query aligns to 30:226/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: D38 (= D40), I39 (≠ T41), T78 (= T79), P79 (= P80), N80 (≠ D81), H83 (= H84), E100 (= E101), K101 (= K102), P102 (= P103), F170 (≠ Y176), Q176 (≠ H179), H187 (= H190)
Sites not aligning to the query:
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
28% identity, 36% coverage: 7:160/433 of query aligns to 5:155/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), G12 (= G14), A13 (≠ N15), Q14 (≠ R16), D36 (= D40), S37 (≠ T41), R41 (= R45), A73 (≠ C78), G74 (≠ T79), L78 (≠ T83), E96 (= E101), K97 (= K102), N125 (= N130)
Sites not aligning to the query:
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
25% identity, 47% coverage: 7:208/433 of query aligns to 3:201/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), H11 (≠ N15), M12 (≠ R16), D33 (= D40), P34 (≠ T41), T35 (≠ N42), S38 (≠ R45), A71 (≠ C78), S72 (≠ T79), P73 (= P80), N74 (≠ D81), H77 (= H84), E96 (= E101), K97 (= K102), E125 (≠ N130), K162 (≠ R172), V163 (vs. gap), W166 (= W173)
8qc2A Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ and sulfoquinovose (sq) (see paper)
25% identity, 47% coverage: 7:208/433 of query aligns to 5:203/363 of 8qc2A
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), H13 (≠ N15), M14 (≠ R16), D35 (= D40), P36 (≠ T41), T37 (≠ N42), S40 (≠ R45), A73 (≠ C78), S74 (≠ T79), P75 (= P80), N76 (≠ D81), H79 (= H84), E98 (= E101), K99 (= K102), E127 (≠ N130), K164 (≠ R172), V165 (vs. gap), W168 (= W173)
- binding sulfoquinovose: K99 (= K102), Y128 (= Y131), R158 (≠ G166), F161 (≠ Y169), L162 (≠ F170), K164 (≠ R172), E181 (≠ H186), H185 (= H190)
Sites not aligning to the query:
8qc8B Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
25% identity, 47% coverage: 7:208/433 of query aligns to 7:205/367 of 8qc8B
- binding nicotinamide-adenine-dinucleotide: H15 (≠ N15), M16 (≠ R16), D37 (= D40), P38 (≠ T41), T39 (≠ N42), S42 (≠ R45), A75 (≠ C78), S76 (≠ T79), P77 (= P80), N78 (≠ D81), H81 (= H84), E100 (= E101), K101 (= K102), E129 (≠ N130), K166 (≠ R172), V167 (vs. gap), W170 (= W173)
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
25% identity, 48% coverage: 5:210/433 of query aligns to 3:206/325 of 1zh8A
- active site: K98 (= K102), H187 (= H190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), C11 (≠ T13), G12 (= G14), I13 (≠ M20), A14 (≠ W21), S37 (≠ D40), R38 (≠ T41), T39 (≠ N42), H42 (≠ R45), T74 (≠ C78), L75 (≠ T79), P76 (= P80), L79 (≠ T83), E97 (= E101), K98 (= K102), N126 (= N130), Y165 (= Y169), W170 (= W173), R171 (≠ H174), H187 (= H190)
Sites not aligning to the query:
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
31% identity, 33% coverage: 7:150/433 of query aligns to 4:146/339 of 4mjlD
- active site: K97 (= K102)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K102)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), A12 (≠ N15), M13 (≠ R16), D35 (= D40), I36 (≠ T41), V73 (≠ C78), S74 (≠ T79), H79 (= H84), E96 (= E101), K97 (= K102), M126 (≠ N130)
Sites not aligning to the query:
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: 155, 157, 172, 173, 176, 236
- binding nicotinamide-adenine-dinucleotide: 172, 274, 282
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
31% identity, 33% coverage: 7:150/433 of query aligns to 4:146/339 of 4mioD
- active site: K97 (= K102)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K102)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ N15), M13 (≠ R16), D35 (= D40), I36 (≠ T41), S74 (≠ T79), A78 (≠ T83), H79 (= H84), E96 (= E101), K97 (= K102), M126 (≠ N130)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 155, 157, 172, 173, 176, 236
- binding 1,4-dihydronicotinamide adenine dinucleotide: 172, 274, 282
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
31% identity, 33% coverage: 7:150/433 of query aligns to 4:146/339 of 4mioA
- active site: K97 (= K102)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G14), A12 (≠ N15), M13 (≠ R16), D35 (= D40), I36 (≠ T41), S74 (≠ T79), F75 (≠ P80), H79 (= H84), E96 (= E101), K97 (= K102)
Sites not aligning to the query:
Query Sequence
>SMc04129 FitnessBrowser__Smeli:SMc04129
MMDNKRRFALVGTGNRGTTMWGRDLLAGWRGLVDLVAIADTNALRAERARTMIATNAPVY
GNVDAMLAETRPDLVIVCTPDDTHDDIVVRALESGADVITEKPMSTTVEKIRRILDAEKR
TGRRVDVSFNYRFAPTAARIKELLNAGEIGRVTSVDFHWYLDTRHGADYFRRWHAYAEHS
GSLFVHKATHHFDLLNWYLDSDPEAVSAFADLQMYGRRGPFRGPRCKLCPHKSECDFYLD
LEADPFLDSLYEEPSEIDSYFRDGCVFREDIDIPDTMVANIRYRNDVHVSYSLNTFQPIE
GHHIAFNGTKGRIELRQYEDQPWETPPEDEILLVRNFPKGKPAMERITVPHFPGGHYGGD
DRLRNTLFEPDAKDPLGQRAGARAGAMSVLCGIAALQSSRTGKIVRLADLMPELFTDGAQ
PMRERLKETCSRR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory