Comparing SMc04133 FitnessBrowser__Smeli:SMc04133 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
23% identity, 89% coverage: 42:380/382 of query aligns to 33:376/378 of 6a3jC
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
23% identity, 89% coverage: 42:380/382 of query aligns to 34:372/372 of 6a3iA
Sites not aligning to the query:
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
23% identity, 89% coverage: 42:381/382 of query aligns to 35:389/390 of F0M433
Sites not aligning to the query:
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
22% identity, 78% coverage: 48:344/382 of query aligns to 33:293/331 of 2poqX
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
22% identity, 78% coverage: 48:344/382 of query aligns to 33:293/331 of 2o4uX
Sites not aligning to the query:
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
22% identity, 78% coverage: 48:344/382 of query aligns to 34:294/334 of Q7JK39
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
22% identity, 78% coverage: 48:344/382 of query aligns to 34:294/334 of Q9TQS6
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
24% identity, 64% coverage: 60:303/382 of query aligns to 42:260/332 of 2glxA
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
24% identity, 64% coverage: 60:303/382 of query aligns to 43:261/333 of Q2I8V6
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
24% identity, 66% coverage: 48:299/382 of query aligns to 31:263/333 of 4koaA
Sites not aligning to the query:
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
28% identity, 77% coverage: 54:349/382 of query aligns to 43:339/366 of 5yaqB
Sites not aligning to the query:
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
28% identity, 77% coverage: 54:349/382 of query aligns to 43:339/366 of 5ya8A
Sites not aligning to the query:
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
28% identity, 77% coverage: 54:349/382 of query aligns to 44:340/368 of 6ktkC
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
23% identity, 71% coverage: 48:320/382 of query aligns to 35:289/325 of 1zh8A
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
35% identity, 29% coverage: 90:200/382 of query aligns to 81:183/332 of B3TMR8
Sites not aligning to the query:
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
35% identity, 29% coverage: 90:200/382 of query aligns to 74:176/325 of 3rc1A
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
21% identity, 57% coverage: 66:284/382 of query aligns to 46:267/344 of 7xr9A
Sites not aligning to the query:
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
23% identity, 53% coverage: 57:257/382 of query aligns to 38:225/355 of 6o15A
Sites not aligning to the query:
7xreC Crystal structure of dgpa
21% identity, 57% coverage: 69:284/382 of query aligns to 59:277/363 of 7xreC
Sites not aligning to the query:
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
26% identity, 68% coverage: 48:308/382 of query aligns to 42:286/349 of 6norA
Sites not aligning to the query:
>SMc04133 FitnessBrowser__Smeli:SMc04133
MPRLGIILHGVTGRMGYNQHLVRSILAIRDRGGITLQSGERLEIDPIIVGRNRDKMEQLA
KRHDIARWSTDLDAALADPNDQIFFDAGTTLMRAELIGRALDAGKHVYCEKPISDDLRTA
VKLARKARASGLKHGVVQDKLFLPGLRKLALLRDSGFFGKILSVRGEFGYWVFEGDWGVP
AQRPSWNYRKKDGGGIILDMLCHWRYVLDNLFGEVKAVSCLGATHIPSRIDEQGRAYDCD
TDDAAYATFELEGGIVAHINSSWAVRVRRDDLVTFQVDGTHGSAVAGLTKCWTQHRVNTP
KPVWNPDQPQTIDFYRTWDEVPDTQAFDNGFKAQWEMFLRHVAEDGPWPHGLEAGAKGVQ
LAELGLKSWAERRWLDVPELEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory