Comparing SMc04142 FitnessBrowser__Smeli:SMc04142 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
31% identity, 97% coverage: 5:289/294 of query aligns to 4:297/299 of Q15493
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
31% identity, 97% coverage: 5:289/294 of query aligns to 2:295/297 of 3g4hA
4gncA Human smp30/gnl-1,5-ag complex (see paper)
31% identity, 97% coverage: 5:289/294 of query aligns to 3:296/298 of 4gncA
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
30% identity, 97% coverage: 5:289/294 of query aligns to 2:295/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
30% identity, 97% coverage: 5:289/294 of query aligns to 2:295/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
30% identity, 97% coverage: 5:289/294 of query aligns to 2:295/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
30% identity, 97% coverage: 5:289/294 of query aligns to 2:295/297 of 4gn7A
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
30% identity, 84% coverage: 14:259/294 of query aligns to 12:270/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
30% identity, 84% coverage: 14:259/294 of query aligns to 12:270/307 of 5d9bA
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
31% identity, 95% coverage: 9:288/294 of query aligns to 7:285/289 of Q9A9Z1
7pldA Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
31% identity, 95% coverage: 9:288/294 of query aligns to 5:283/287 of 7pldA
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
31% identity, 95% coverage: 9:288/294 of query aligns to 7:285/289 of 7plbB
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
27% identity, 82% coverage: 18:258/294 of query aligns to 44:288/299 of 3dr2A
>SMc04142 FitnessBrowser__Smeli:SMc04142
MSFDLTFECLLDSRCDVAESPVFDERRNCLFFVDIGRSALHRVDLSGAGHVEWTIEGGAC
STGLARSGRLVLAQRDRVVLFDPDAGAVTREIAAIEPDIADTRLNDGKVGPDGAFWVGTM
HDVPDRRPVASLYRVSPEGAVERKVEGVVCSNGLAWSGDGSLLFHSDSRGAWIDRWQFDP
ATGALSGRRRLASLDEASGRPDGAATDAEAHYWSAGVSAGIVNRFSPEGRLVGTHRFPVP
APTMPCFAGPDLKTLLVTSLRPAGIGKENRSGGIFVARSPVAGVAVHRFDDRWI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory