SitesBLAST
Comparing SMc04145 FitnessBrowser__Smeli:SMc04145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
55% identity, 95% coverage: 4:252/261 of query aligns to 4:255/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S74), S110 (≠ T110), N111 (= N111), H112 (= H112), Y135 (= Y135), S164 (= S164), R173 (= R173)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G12 (= G12), Q13 (≠ G13), L14 (= L14), D33 (= D33), L34 (≠ V34), D50 (= D50), L51 (= L51), L70 (= L70), G71 (= G71), G72 (≠ A72), S74 (= S74), A108 (= A108), S110 (≠ T110), Y135 (= Y135), K139 (= K139), I162 (= I162), S164 (= S164), C165 (= C165)
Sites not aligning to the query:
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
55% identity, 95% coverage: 4:252/261 of query aligns to 3:254/265 of Q7CRQ0
- Y134 (= Y135) mutation to A: 0.1% of wild-type activity.
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
55% identity, 95% coverage: 4:252/261 of query aligns to 4:255/265 of 3rfxA
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
37% identity, 61% coverage: 5:162/261 of query aligns to 3:160/328 of 4id9B
- active site: S107 (≠ T110), Y133 (= Y135), K137 (= K139)
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), R11 (≠ G13), V12 (≠ L14), D31 (= D33), L32 (= L37), S45 (≠ D50), L46 (= L51), L65 (= L70), A67 (= A72), V82 (≠ A85), Y133 (= Y135), K137 (= K139), F160 (≠ I162)
Sites not aligning to the query:
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
37% identity, 61% coverage: 5:162/261 of query aligns to 2:159/321 of 4id9A
- active site: S106 (≠ T110), Y132 (= Y135), K136 (= K139)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), R10 (≠ G13), V11 (≠ L14), D30 (= D33), L31 (= L37), R32 (≠ S38), S44 (≠ D50), L45 (= L51), L64 (= L70), A66 (= A72), V81 (≠ A85), S106 (≠ T110), Y132 (= Y135), K136 (= K139), F159 (≠ I162)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
32% identity, 64% coverage: 5:170/261 of query aligns to 2:175/315 of 3a1nA
- active site: T112 (= T110), Y137 (= Y135), K141 (= K139)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A11), G9 (= G12), Q10 (≠ G13), I11 (≠ L14), D32 (= D33), I33 (≠ V34), L46 (≠ C49), D47 (= D50), L69 (= L70), A70 (vs. gap), G71 (= G71), L73 (≠ I73), S111 (= S109), Y137 (= Y135), K141 (= K139), Y164 (vs. gap)
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
32% identity, 64% coverage: 5:170/261 of query aligns to 2:175/311 of 3a4vA
- active site: T112 (= T110), Y137 (= Y135), K141 (= K139)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A11), G9 (= G12), Q10 (≠ G13), I11 (≠ L14), D32 (= D33), I33 (≠ V34), L46 (≠ C49), D47 (= D50), V48 (≠ L51), L69 (= L70), A70 (vs. gap), G71 (= G71), L73 (≠ I73), P110 (≠ A108), S111 (= S109), T112 (= T110), Y137 (= Y135), K141 (= K139), Y164 (vs. gap), I167 (= I162)
- binding pyruvic acid: S74 (= S74), Y137 (= Y135)
Sites not aligning to the query:
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
31% identity, 71% coverage: 5:190/261 of query aligns to 2:184/290 of 3eheA
- active site: T111 (= T110), S112 (≠ N111), T113 (≠ H112), Y135 (= Y135), K139 (= K139)
- binding nicotinamide-adenine-dinucleotide: G6 (= G9), G9 (= G12), F10 (≠ G13), I11 (≠ L14), D29 (≠ S32), N30 (≠ D33), L31 (≠ V34), S32 (≠ A35), S33 (≠ T36), G34 (≠ L37), D49 (= D50), L50 (= L51), I68 (≠ L70), A69 (≠ G71), A70 (= A72), T109 (≠ A108), Y135 (= Y135), K139 (= K139), F162 (= F166), A163 (= A167), N164 (≠ E168), V165 (≠ P169)
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
31% identity, 64% coverage: 5:170/261 of query aligns to 2:175/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A11), G9 (= G12), Q10 (≠ G13), I11 (≠ L14), D32 (= D33), I33 (≠ V34), L46 (≠ C49), D47 (= D50), V48 (≠ L51), L69 (= L70), A70 (vs. gap), L73 (≠ I73), V87 (≠ A85), P110 (≠ A108), S111 (= S109), K141 (= K139), Y164 (vs. gap), I167 (= I162)
- binding threonine: S74 (= S74), T112 (= T110), F137 (≠ Y135)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
31% identity, 64% coverage: 5:170/261 of query aligns to 2:175/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A11), G9 (= G12), Q10 (≠ G13), I11 (≠ L14), D32 (= D33), I33 (≠ V34), L46 (≠ C49), D47 (= D50), V48 (≠ L51), L69 (= L70), A70 (vs. gap), G71 (= G71), L73 (≠ I73), P110 (≠ A108), S111 (= S109), T112 (= T110), F137 (≠ Y135), K141 (= K139), Y164 (vs. gap), I167 (= I162)
- binding (3R)-3-hydroxy-L-norvaline: S74 (= S74), T112 (= T110), I113 (≠ N111), F137 (≠ Y135)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
32% identity, 62% coverage: 4:166/261 of query aligns to 3:175/308 of 6wj9B
- active site: A119 (≠ T110), A120 (≠ N111), A121 (≠ H112), F144 (≠ Y135), K148 (= K139)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (≠ G13), I13 (≠ L14), D32 (= D27), D33 (≠ V28), S35 (≠ R30), T36 (≠ L31), G37 (≠ S32), D55 (= D50), A56 (≠ L51), L75 (= L70), A76 (≠ G71), A77 (= A72), S94 (≠ A85), A117 (= A108), A119 (≠ T110), F144 (≠ Y135), K148 (= K139), F171 (≠ I162), F172 (≠ G163), I174 (≠ C165)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V75), N173 (≠ S164)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
32% identity, 62% coverage: 4:166/261 of query aligns to 2:174/307 of 6wjaA
- active site: A118 (≠ T110), A119 (≠ N111), A120 (≠ H112), F143 (≠ Y135), K147 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ G13), I12 (≠ L14), D31 (= D27), D32 (≠ V28), S34 (≠ R30), T35 (≠ L31), G36 (≠ S32), A55 (≠ L51), L74 (= L70), A75 (≠ G71), A76 (= A72), S93 (≠ A85), F143 (≠ Y135), K147 (= K139), F170 (≠ I162), F171 (≠ G163), I173 (≠ C165)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V75), A120 (≠ H112), N172 (≠ S164)
Sites not aligning to the query:
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
31% identity, 80% coverage: 4:212/261 of query aligns to 2:217/322 of 1r6dA
- active site: T127 (= T110), N128 (= N111), Q129 (≠ H112), Y151 (= Y135), K155 (= K139)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S77), H88 (≠ D78), T127 (= T110), N128 (= N111), Q129 (≠ H112), Y151 (= Y135), N180 (≠ A167), K190 (≠ D183), L191 (≠ F184), P206 (≠ V201), Y208 (= Y203), R215 (≠ D210)
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), F11 (≠ G13), I12 (≠ L14), D37 (= D33), S38 (≠ V34), L39 (vs. gap), T40 (vs. gap), A42 (vs. gap), G43 (vs. gap), D63 (= D50), I64 (≠ L51), F83 (≠ L70), A84 (≠ G71), A85 (= A72), S87 (= S77), T102 (≠ A85), V125 (≠ A108), S126 (= S109), Y151 (= Y135), K155 (= K139), N181 (≠ E168)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
31% identity, 80% coverage: 4:212/261 of query aligns to 2:217/322 of 1r66A
- active site: T127 (= T110), D128 (≠ N111), E129 (≠ H112), Y151 (= Y135), K155 (= K139)
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), F11 (≠ G13), I12 (≠ L14), D37 (= D33), S38 (≠ V34), L39 (vs. gap), T40 (vs. gap), G43 (vs. gap), D63 (= D50), I64 (≠ L51), F83 (≠ L70), A84 (≠ G71), A85 (= A72), S87 (= S77), T102 (≠ A85), V125 (≠ A108), S126 (= S109), Y151 (= Y135), K155 (= K139), N181 (≠ E168)
- binding thymidine-5'-diphosphate: H88 (≠ D78), E129 (≠ H112), N180 (≠ A167), K190 (≠ D183), L191 (≠ F184), P206 (≠ V201), Y208 (= Y203), R215 (≠ D210)
Sites not aligning to the query:
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
28% identity, 59% coverage: 4:157/261 of query aligns to 3:182/344 of 1bxkB
- active site: S125 (≠ G101), T134 (= T110), D135 (≠ N111), E136 (≠ H112), S158 (= S133), Y160 (= Y135), S161 (≠ G136), K164 (= K139)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (≠ G13), I13 (≠ L14), D33 (= D33), K34 (vs. gap), L35 (vs. gap), T36 (vs. gap), A38 (vs. gap), G39 (vs. gap), D59 (= D50), I60 (≠ L51), L81 (= L70), A83 (= A72), T100 (≠ A85), I132 (≠ A108), S133 (= S109), T134 (= T110), K164 (= K139)
Sites not aligning to the query:
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 59% coverage: 4:157/261 of query aligns to 3:182/355 of P27830
- FI 12:13 (≠ GL 13:14) binding
- DKLT 33:36 (≠ D--- 33) binding
- DI 59:60 (≠ DL 50:51) binding
- T100 (≠ A85) binding
- D135 (≠ N111) active site, Proton donor
- E136 (≠ H112) active site, Proton acceptor
- Y160 (= Y135) active site, Proton acceptor
- YSASK 160:164 (≠ YGVSK 135:139) binding
Sites not aligning to the query:
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
28% identity, 88% coverage: 4:233/261 of query aligns to 3:243/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (≠ G13), I13 (≠ L14), D32 (≠ A26), N33 (≠ D27), N35 (≠ L29), Y38 (≠ S32), K43 (≠ L37), D61 (= D50), L62 (= L51), L83 (= L70), A84 (≠ G71), A85 (= A72), A123 (= A108), Y150 (= Y135), K154 (= K139), F177 (≠ I162), V180 (≠ C165), R186 (= R172), M189 (vs. gap)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
30% identity, 62% coverage: 4:166/261 of query aligns to 2:174/311 of 2p5uA
- active site: T117 (= T110), G119 (vs. gap), A120 (≠ H112), Y143 (= Y135), K147 (= K139)
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), F11 (≠ G13), I12 (≠ L14), D31 (≠ S32), N32 (≠ D33), L33 (≠ V34), A34 (= A35), T35 (= T36), G36 (vs. gap), D51 (= D50), L52 (= L51), Q73 (≠ I73), A74 (≠ S74), A75 (≠ V75), A77 (≠ S77), S116 (= S109), Y143 (= Y135), K147 (= K139), V173 (≠ C165)
Sites not aligning to the query:
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
29% identity, 61% coverage: 4:161/261 of query aligns to 2:165/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Q11 (≠ G13), I12 (≠ L14), D33 (= D33), I34 (≠ V34), R35 (vs. gap), L48 (≠ I46), D49 (= D50), V50 (≠ L51), A72 (≠ G71), A73 (= A72), L75 (vs. gap), P112 (≠ A108), S114 (≠ T110), Y139 (= Y135), K143 (= K139)
Sites not aligning to the query:
3aw9A Structure of udp-galactose 4-epimerase mutant
25% identity, 62% coverage: 4:165/261 of query aligns to 2:161/304 of 3aw9A
- active site: A105 (= A108), S107 (≠ T110), S108 (≠ N111), T109 (≠ H112), Y131 (= Y135), K135 (= K139)
- binding galactose-uridine-5'-diphosphate: P69 (≠ Q59), V71 (= V61), S107 (≠ T110), Y131 (= Y135), N160 (≠ S164)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ G13), I12 (≠ L14), D31 (= D33), I32 (≠ V34), R46 (= R48), D47 (vs. gap), L48 (vs. gap), F65 (≠ E55), A66 (= A56), A67 (≠ V57), E82 (≠ A85), A105 (= A108), S106 (= S109), Y131 (= Y135), K135 (= K139), Y158 (≠ I162), N160 (≠ S164), V161 (≠ C165)
Sites not aligning to the query:
- active site: 166, 169
- binding galactose-uridine-5'-diphosphate: 168, 170, 173, 188, 193, 195, 197, 234, 263, 266
- binding nicotinamide-adenine-dinucleotide: 168
Query Sequence
>SMc04145 FitnessBrowser__Smeli:SMc04145
MTTRLLITGAAGGLGRYAREGLKGCADVLRLSDVATLSPAGEGEEIVRCDLAEREAVDQL
VRGCDAILHLGAISVESDFDALLQANILGTYNLYEAARKAGVNRILFASTNHVTGFHPIG
ETLDHLSPRRPDSLYGVSKCFGEDLSRLYFDKYGMETACLRIGSCFAEPTNRRMLSTWLS
PRDFLALVRRLLDAPKIGHLVLYGVSANRDVWWSNGHADFLGWRPQDSSEPYRHEIEKRE
EEPSDGVRYQGGRHAAAKLPG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory