Comparing SMc04251 FitnessBrowser__Smeli:SMc04251 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
79% identity, 100% coverage: 1:368/368 of query aligns to 1:365/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
81% identity, 91% coverage: 33:368/368 of query aligns to 2:337/337 of 2hzlB
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
50% identity, 88% coverage: 32:355/368 of query aligns to 2:328/344 of 4yicA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
50% identity, 85% coverage: 33:343/368 of query aligns to 3:313/330 of 7ug8B
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
38% identity, 84% coverage: 34:343/368 of query aligns to 2:312/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
33% identity, 85% coverage: 32:343/368 of query aligns to 1:313/329 of 4petA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 64% coverage: 1:235/368 of query aligns to 4:234/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
33% identity, 50% coverage: 51:235/368 of query aligns to 18:203/330 of 2zzwA
Sites not aligning to the query:
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
33% identity, 50% coverage: 51:235/368 of query aligns to 18:203/330 of 2zzvA
Sites not aligning to the query:
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
30% identity, 67% coverage: 56:302/368 of query aligns to 21:266/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
32% identity, 45% coverage: 51:214/368 of query aligns to 18:182/563 of 7e9yA
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
24% identity, 85% coverage: 33:343/368 of query aligns to 1:306/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
23% identity, 84% coverage: 35:343/368 of query aligns to 2:305/315 of 4uabA
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
32% identity, 44% coverage: 141:301/368 of query aligns to 139:294/330 of Q128M1
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
32% identity, 44% coverage: 141:301/368 of query aligns to 109:264/302 of 4mijA
Sites not aligning to the query:
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
32% identity, 44% coverage: 141:301/368 of query aligns to 109:264/301 of 4mhfA
Sites not aligning to the query:
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
24% identity, 61% coverage: 55:278/368 of query aligns to 21:243/301 of 4pdhA
Sites not aligning to the query:
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
30% identity, 42% coverage: 147:301/368 of query aligns to 111:264/300 of 4n8yA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
23% identity, 57% coverage: 55:265/368 of query aligns to 23:231/303 of 4p9kA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
23% identity, 57% coverage: 55:265/368 of query aligns to 24:232/304 of 4pakA
Sites not aligning to the query:
>SMc04251 FitnessBrowser__Smeli:SMc04251
MDRRSFIKHASIGGLGAAAASALAAPAIAQTNPKVTWRLTSSFPKSLDTIYGGAEVLSKY
VSEATDGNFQIQVFAAGEIVPGLQAADAAAAGTVEACHTVAYYYWGKDPTWALGAAVPFA
LNARGMNAWHYHGGGIDLFNEFLGTQGLVGYPGGNTGVQMGGWFRKEIKTVADMKGLKMR
VGGFAGKVMERLGVVPQQLAGGDIYPALEKGTIDAAEWVGPYDDEKLGFYKVAPYYYYPG
WWEGGPTVHAMFNKAAFDGLPKAYQSLLRTACQATDANMLQKYDYLNPSAIKRLVAAGAK
LSPFSPEILSACFDESNKVYAEMEASNAPFKKIWESIKAFRAEYFLNAQIAEYNYDTFMM
IQQRNGKI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory