Comparing SMc04289 FitnessBrowser__Smeli:SMc04289 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
33% identity, 84% coverage: 37:354/379 of query aligns to 1:317/330 of 7ug8B
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
32% identity, 85% coverage: 39:361/379 of query aligns to 32:351/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
32% identity, 85% coverage: 39:361/379 of query aligns to 4:323/337 of 2hzlB
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
29% identity, 87% coverage: 42:369/379 of query aligns to 5:329/329 of 4petA
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
29% identity, 83% coverage: 42:356/379 of query aligns to 4:318/331 of 5cm6A
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
29% identity, 83% coverage: 40:354/379 of query aligns to 4:317/344 of 4yicA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 72% coverage: 10:282/379 of query aligns to 4:280/361 of Q5SK82
Sites not aligning to the query:
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
30% identity, 63% coverage: 41:277/379 of query aligns to 3:236/315 of 4pe3A
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
30% identity, 64% coverage: 42:282/379 of query aligns to 4:249/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
30% identity, 64% coverage: 42:282/379 of query aligns to 4:249/330 of 2zzvA
7e9yA Crystal structure of elacco1 (see paper)
32% identity, 47% coverage: 42:220/379 of query aligns to 4:182/563 of 7e9yA
Sites not aligning to the query:
6wgmA Crystal structure of a marine metagenome trap solute binding protein specific for pyroglutamate (sorcerer ii global ocean sampling expedition, unidentified microbe, scf7180008839099) in complex with co-purified pyroglutamate
26% identity, 74% coverage: 40:318/379 of query aligns to 3:274/304 of 6wgmA
4n6dA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site (see paper)
23% identity, 64% coverage: 62:304/379 of query aligns to 26:269/319 of 4n6dA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
23% identity, 64% coverage: 39:281/379 of query aligns to 4:241/304 of 4x8rA
4mncA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21 (see paper)
26% identity, 48% coverage: 39:220/379 of query aligns to 3:175/305 of 4mncA
Sites not aligning to the query:
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
25% identity, 69% coverage: 60:321/379 of query aligns to 23:280/301 of 4x04A
Sites not aligning to the query:
2pfyA Crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
26% identity, 61% coverage: 48:277/379 of query aligns to 11:232/301 of 2pfyA
4ovtA Crystal structure of a trap periplasmic solute binding protein from ochrobacterium anthropi (oant_3902), target efi-510153, with bound l- fuconate (see paper)
35% identity, 29% coverage: 171:280/379 of query aligns to 131:240/301 of 4ovtA
Sites not aligning to the query:
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
33% identity, 29% coverage: 169:277/379 of query aligns to 152:259/328 of Q0B2F6
Sites not aligning to the query:
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
33% identity, 29% coverage: 169:277/379 of query aligns to 126:233/301 of 4n17A
Sites not aligning to the query:
>SMc04289 FitnessBrowser__Smeli:SMc04289
MKHRAESGGTSRRRFLRGAAAAGAAMAAAPSIVRAQGPVSMRWQSTWPSKDIFHEFALDF
AKKVNDMTGGDLKIEVLPAGAVVPAFGLLDAVSEGTLDGGHGVMVYHYGKQTALALWGSG
PGFAMDANMMLAWHKYGGGRDLLAKLYESIGANVVSFPYGPMPTQPLGWFKKPVAKAEDL
QGLKFRTVGISIDVFTGLGAAVNALPGGEIVAALDRGLLDAAEFNNASSDRLLGFPDVSK
VCMLQGYHQNAETFEILFNKGKFDGLPDQMKAIISNAVDAASADMAWKAIDRYSTDYREM
QTADQVKFYKTPEAILKRQLEVYDEVVKKKSAENPVFKEVLQSQIAFAERATRWEQDTVV
NRRMAFDHYFGRDGVAKSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory