Comparing SMc04394 FitnessBrowser__Smeli:SMc04394 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
27% identity, 92% coverage: 25:293/293 of query aligns to 20:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
29% identity, 67% coverage: 97:293/293 of query aligns to 100:296/296 of P68183
>SMc04394 FitnessBrowser__Smeli:SMc04394
MGAPNPENVISHNRLTRALIYSALILFALYSLLPLYVMLVNSLKPLDEIRQGGMLNLPQT
WTVEPWLSAWSTAQIGVQPTGLRPFFINSILMVVPAVAISTIIGALNGYVLTKWRFPGAN
IFFGMLLLSCFIPFQIVLIPMARILGILGIAGSIWGLILVHVVYGIGFTTLYFRNYYEAF
PTELVRAAQIDGASFFQIFRRILLPSSGPIIVVSVIWQFTNIWNDFLFGASFSGPYSTPM
TVALNNLVSSSTGVKEYNVHFAGAILAALPTLIVYIVSGRYFVRGLMSGAVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory