SitesBLAST
Comparing SMc04400 FitnessBrowser__Smeli:SMc04400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
100% identity, 100% coverage: 1:333/333 of query aligns to 1:333/333 of 4koaA
- active site: K94 (= K94), H180 (= H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), A9 (= A9), S10 (= S10), T11 (= T11), I12 (= I12), S33 (= S33), S34 (= S34), R38 (= R38), T71 (= T71), N73 (= N73), H76 (= H76), K94 (= K94), Q160 (= Q160)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
87% identity, 99% coverage: 3:333/333 of query aligns to 2:332/332 of 2glxA
- active site: K93 (= K94), H179 (= H180)
- binding acetate ion: K93 (= K94), H179 (= H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), A8 (= A9), S9 (= S10), T10 (= T11), I11 (= I12), S32 (= S33), T33 (≠ S34), R37 (= R38), S69 (= S70), T70 (= T71), N72 (= N73), H75 (= H76), E92 (= E93), K93 (= K94), H121 (= H122), W161 (= W162), R162 (= R163), Y282 (= Y283)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
86% identity, 100% coverage: 1:333/333 of query aligns to 1:333/333 of Q2I8V6
- ASTI 9:12 (= ASTI 9:12) binding
- S10 (= S10) mutation to G: Almost no effect.
- A13 (= A13) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S33) mutation to D: No activity.
- ST 33:34 (≠ SS 33:34) binding
- R38 (= R38) binding
- TTNELH 71:76 (= TTNELH 71:76) binding
- EK 93:94 (= EK 93:94) binding
- K94 (= K94) mutation to G: Less than 1% remaining activity.
- N120 (= N120) binding
- WR 162:163 (= WR 162:163) binding
- D176 (= D176) mutation to A: Less than 1% remaining activity.
- H180 (= H180) mutation to A: Less than 2% remaining activity.
- G206 (= G206) mutation to I: No effect.
- Y283 (= Y283) binding
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
26% identity, 92% coverage: 28:332/333 of query aligns to 61:376/383 of 1h6dA
- active site: K131 (= K94), Y219 (≠ H180)
- binding glycerol: K131 (= K94), R202 (= R163), D215 (= D176), Y219 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S66 (= S33), G67 (≠ S34), K71 (≠ R38), Y89 (≠ V52), I107 (≠ S70), L108 (≠ T71), P109 (≠ T72), N110 (= N73), H113 (= H76), E130 (= E93), K131 (= K94), R159 (≠ H122), A198 (≠ L159), W201 (= W162), R202 (= R163), Y219 (≠ H180), Y298 (vs. gap)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
26% identity, 92% coverage: 28:332/333 of query aligns to 59:374/381 of 1rydA
- active site: K129 (= K94), Y217 (≠ H180)
- binding alpha-D-glucopyranose: Y236 (≠ I199), I254 (≠ M215), Q256 (≠ V217)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S64 (= S33), G65 (≠ S34), K69 (≠ R38), Y87 (≠ V52), L106 (≠ T71), P107 (≠ T72), N108 (= N73), L110 (= L75), H111 (= H76), E128 (= E93), K129 (= K94), R157 (≠ H122), A196 (≠ L159), W199 (= W162), R200 (= R163), Y217 (≠ H180), Y296 (vs. gap)
Sites not aligning to the query:
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
30% identity, 97% coverage: 2:324/333 of query aligns to 3:314/322 of 3q2kK
- active site: K95 (= K94), H183 (= H180)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ T11), K95 (= K94), T155 (≠ L155), R156 (≠ P156), Y160 (vs. gap), N179 (≠ D176), Q180 (≠ I177), H183 (= H180), N239 (≠ F236)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G11 (≠ S10), R12 (≠ T11), I13 (= I12), D35 (≠ S33), T36 (≠ S34), T72 (= T71), P73 (≠ T72), S74 (≠ N73), L76 (= L75), H77 (= H76), E94 (= E93), K95 (= K94), Q123 (≠ H122), W166 (= W162), R167 (= R163), H183 (= H180)
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
27% identity, 92% coverage: 28:332/333 of query aligns to 30:333/340 of 1evjA
- active site: K100 (= K94), Y188 (≠ H180)
- binding nicotinamide-adenine-dinucleotide: D35 (≠ S33), L77 (≠ T71), P78 (≠ T72), N79 (= N73), H82 (= H76), E99 (= E93), K100 (= K94), R128 (≠ H122), W170 (= W162), R171 (= R163), Y188 (≠ H180), Y267 (≠ V265)
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
29% identity, 97% coverage: 2:324/333 of query aligns to 8:339/347 of 3q2kC
- active site: K100 (= K94), H188 (= H180)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ T11), K100 (= K94), W159 (≠ Y154), T160 (≠ L155), R161 (≠ P156), Y165 (vs. gap), N184 (≠ D176), Q185 (≠ I177), H188 (= H180), Q243 (≠ K235), N244 (≠ F236)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (≠ S10), R17 (≠ T11), I18 (= I12), D40 (≠ S33), T41 (≠ S34), A76 (≠ S70), T77 (= T71), S79 (≠ N73), H82 (= H76), Q85 (= Q79), E99 (= E93), K100 (= K94), Q128 (≠ H122), W171 (= W162), R172 (= R163)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
26% identity, 91% coverage: 28:329/333 of query aligns to 31:336/336 of 5a06A
- active site: K101 (= K94), Y186 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (= S33), G37 (≠ S34), T38 (≠ S35), K41 (≠ R38), Y59 (≠ V52), I77 (≠ S70), T78 (= T71), P79 (≠ T72), N80 (= N73), L82 (= L75), H83 (= H76), E100 (= E93), K101 (= K94), R129 (≠ H122), W168 (= W162), R169 (= R163), Y186 (≠ H180), Y264 (≠ T257)
- binding sorbitol: D72 (= D65), H96 (= H89), K101 (= K94), R122 (≠ V115), R122 (≠ V115), L124 (= L117), F160 (≠ Y154), R169 (= R163), D182 (= D176), Y186 (≠ H180), K287 (≠ R280), H296 (≠ A289), E299 (≠ S292), E306 (≠ R299), G310 (≠ S303), G311 (= G304)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 91% coverage: 28:329/333 of query aligns to 31:336/336 of 5a03C
- active site: K101 (= K94), Y186 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (= S33), G37 (≠ S34), T38 (≠ S35), K41 (≠ R38), Y59 (≠ V52), I77 (≠ S70), T78 (= T71), P79 (≠ T72), N80 (= N73), L82 (= L75), H83 (= H76), E100 (= E93), K101 (= K94), R129 (≠ H122), W168 (= W162), R169 (= R163), Y186 (≠ H180), Y264 (≠ T257)
- binding beta-D-xylopyranose: K101 (= K94), F160 (≠ Y154), R169 (= R163), D182 (= D176), Y186 (≠ H180)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 91% coverage: 28:329/333 of query aligns to 30:335/335 of 5a05A
- active site: K100 (= K94), Y185 (≠ H180)
- binding beta-D-glucopyranose: K100 (= K94), F159 (≠ Y154), D181 (= D176), Y185 (≠ H180)
- binding alpha-D-glucopyranose: P259 (≠ R253), S262 (≠ M256)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (= S33), G36 (≠ S34), T37 (≠ S35), K40 (≠ R38), Y58 (≠ V52), I76 (≠ S70), T77 (= T71), P78 (≠ T72), N79 (= N73), L81 (= L75), H82 (= H76), E99 (= E93), K100 (= K94), R128 (≠ H122), W167 (= W162), R168 (= R163), Y185 (≠ H180), Y263 (≠ T257)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 91% coverage: 28:329/333 of query aligns to 30:335/335 of 5a04A
- active site: K100 (= K94), Y185 (≠ H180)
- binding beta-D-glucopyranose: K100 (= K94), F159 (≠ Y154), R168 (= R163), D181 (= D176), Y185 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (= S33), G36 (≠ S34), T37 (≠ S35), K40 (≠ R38), Y58 (≠ V52), I76 (≠ S70), T77 (= T71), P78 (≠ T72), N79 (= N73), L81 (= L75), H82 (= H76), E99 (= E93), K100 (= K94), R128 (≠ H122), W167 (= W162), R168 (= R163), Y185 (≠ H180), Y263 (≠ T257)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 91% coverage: 28:329/333 of query aligns to 30:335/335 of 5a03E
- active site: K100 (= K94), Y185 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (= S33), G36 (≠ S34), T37 (≠ S35), K40 (≠ R38), Y58 (≠ V52), I76 (≠ S70), T77 (= T71), P78 (≠ T72), N79 (= N73), H82 (= H76), E99 (= E93), K100 (= K94), R128 (≠ H122), W167 (= W162), R168 (= R163), Y185 (≠ H180), Y263 (≠ T257)
- binding beta-D-xylopyranose: K100 (= K94), F159 (≠ Y154), R168 (= R163), D181 (= D176), Y185 (≠ H180), E205 (≠ S200), T207 (≠ S202), R209 (≠ G204)
- binding alpha-D-xylopyranose: H134 (≠ T128), M268 (≠ G262), R279 (≠ S273), E280 (= E274)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
26% identity, 91% coverage: 28:329/333 of query aligns to 30:335/335 of 5a02A
- active site: K100 (= K94), Y185 (≠ H180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S35 (= S33), G36 (≠ S34), T37 (≠ S35), K40 (≠ R38), Y58 (≠ V52), I76 (≠ S70), T77 (= T71), P78 (≠ T72), L81 (= L75), H82 (= H76), E99 (= E93), K100 (= K94), R128 (≠ H122), W167 (= W162), R168 (= R163), Y185 (≠ H180), Y263 (≠ T257)
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
26% identity, 90% coverage: 29:329/333 of query aligns to 28:341/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (= H121), Q173 (≠ I177), H176 (= H180), E242 (≠ T246), M243 (≠ A247), R295 (≠ A289)
- binding nicotinamide-adenine-dinucleotide: D35 (≠ A36), P36 (≠ E37), R37 (= R38), A71 (≠ S70), S72 (≠ T71), P73 (≠ T72), F76 (≠ L75), Q80 (= Q79), E94 (= E93), K95 (= K94), P96 (= P95), R161 (≠ D165), P163 (= P167), E164 (= E168)
Sites not aligning to the query:
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
27% identity, 74% coverage: 2:248/333 of query aligns to 2:244/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
27% identity, 74% coverage: 2:248/333 of query aligns to 2:244/331 of 2o4uX
- binding phosphate ion: L2 (≠ I2), S8 (≠ G8), V9 (≠ A9), A35 (≠ S33), R36 (≠ S34), R40 (= R38), Y57 (≠ V55), N101 (= N99), A103 (≠ N101), D145 (≠ R143), R147 (≠ I145), K155 (≠ V153), Q232 (≠ K235), S234 (≠ A237), T236 (= T239)
Sites not aligning to the query:
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
27% identity, 74% coverage: 2:248/333 of query aligns to 3:245/334 of Q7JK39
- H79 (= H76) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (≠ H180) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
27% identity, 74% coverage: 2:248/333 of query aligns to 3:245/334 of Q9TQS6
- R148 (≠ I145) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
- R202 (≠ K207) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
32% identity, 70% coverage: 17:250/333 of query aligns to 19:249/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: D33 (≠ V31), L34 (≠ M32), T70 (≠ S70), T71 (= T71), P72 (≠ T72), N73 (= N73), L75 (= L75), H76 (= H76), Q79 (= Q79), E93 (= E93), K94 (= K94), N122 (≠ H122), W161 (= W162), H179 (= H180)
Sites not aligning to the query:
Query Sequence
>SMc04400 FitnessBrowser__Smeli:SMc04400
MIRWGLIGASTIAREWVIGAIRAAGGEVVSVMSSSAERGEAYAAENGIAKAVTSVDDLVG
DPDVDAVYISTTNELHHGQALAAIRAGKHVLCEKPLAMNLNDGCEMVLKACEAGVVLGTN
HHLRNAATHRAMREAIAAGRIGRPIAARVFHAVYLPPHLQGWRLDKPEAGGGVILDITVH
DADTLRFVLNDDPIEAVAISHSAGMGKEGLEDGVMGVLRFRSGVIAQFHDAFTTKFAETG
LEVHGTAGSLIGRNVMTQRPVGTVVLRNEEGESELPLDHRNLYETAIAAFHSAIGGNGRP
SASGEDGVWSLATGLAVVKAAATGGAVEIETGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory