Comparing SMc04439 FitnessBrowser__Smeli:SMc04439 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
58% identity, 77% coverage: 4:232/297 of query aligns to 52:273/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
58% identity, 77% coverage: 4:232/297 of query aligns to 52:273/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
60% identity, 70% coverage: 4:211/297 of query aligns to 52:259/260 of 7ahdC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 73% coverage: 3:219/297 of query aligns to 42:252/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
42% identity, 72% coverage: 4:218/297 of query aligns to 28:239/241 of 4u00A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 73% coverage: 1:216/297 of query aligns to 28:242/343 of P30750
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 72% coverage: 4:218/297 of query aligns to 27:239/240 of 4ymuJ
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 73% coverage: 1:216/297 of query aligns to 29:243/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 73% coverage: 1:216/297 of query aligns to 29:243/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 73% coverage: 1:216/297 of query aligns to 29:243/344 of 3tuiC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 71% coverage: 4:215/297 of query aligns to 32:243/375 of 2d62A
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 72% coverage: 4:218/297 of query aligns to 29:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 72% coverage: 4:218/297 of query aligns to 29:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 72% coverage: 4:218/297 of query aligns to 29:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 72% coverage: 4:218/297 of query aligns to 29:241/242 of 2oljA
Sites not aligning to the query:
1g291 Malk (see paper)
35% identity, 71% coverage: 4:215/297 of query aligns to 29:240/372 of 1g291
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
36% identity, 76% coverage: 3:227/297 of query aligns to 25:242/348 of 3d31A
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
42% identity, 65% coverage: 4:196/297 of query aligns to 31:226/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
42% identity, 65% coverage: 4:196/297 of query aligns to 31:226/230 of 1l2tA
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
36% identity, 71% coverage: 4:215/297 of query aligns to 32:229/353 of 1vciA
Sites not aligning to the query:
>SMc04439 FitnessBrowser__Smeli:SMc04439
MPGGCITVVMGLSGSGKSTLIRHINRLIDPTSGEVLYDGVDVCKMNENDLRAFRRHKTAM
VFQKFALLPHRTVLENTIYGLEIQGVDRRESEKRALGWIERVGLQGFEKHYPNQLSGGMQ
QRVGLARALTNDADILLMDEAYSALDPLIRVDMQSVLLELQKELKKTVVFITHDLDEALR
LGDKIAILRDGRVVQQGTGQEIVLSPADDYITAFVKEVNRGRVVNVETIMRPLSGNPEGL
PLAAGTVLEAAARTMTGAQISNAHVVDANGRPIGAIDLQMIISAMVTPVQHTDRQAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory