Comparing SO3965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
Q84F84 Phosphocarrier protein HPr; Histidine-containing protein from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
37% identity, 86% coverage: 6:83/91 of query aligns to 4:81/88 of Q84F84
Q9CJ83 Phosphocarrier protein HPr; Histidine-containing protein from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
39% identity, 82% coverage: 6:80/91 of query aligns to 4:78/88 of Q9CJ83
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
38% identity, 90% coverage: 8:89/91 of query aligns to 160:241/472 of P37349
Sites not aligning to the query:
P24366 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus salivarius (see paper)
40% identity, 82% coverage: 6:80/91 of query aligns to 4:78/87 of P24366
O69250 Phosphocarrier protein HPr; Histidine-containing protein from Priestia megaterium (Bacillus megaterium) (see 2 papers)
40% identity, 82% coverage: 5:79/91 of query aligns to 3:77/88 of O69250
O06976 HPr-like protein Crh; Catabolite repression HPr from Bacillus subtilis (strain 168) (see 3 papers)
34% identity, 88% coverage: 4:83/91 of query aligns to 2:81/85 of O06976
P08877 Phosphocarrier protein HPr; Histidine-containing protein from Bacillus subtilis (strain 168) (see 5 papers)
42% identity, 71% coverage: 15:79/91 of query aligns to 13:77/88 of P08877
Sites not aligning to the query:
1pohA The 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination (see paper)
35% identity, 88% coverage: 4:83/91 of query aligns to 2:81/85 of 1pohA
1j6tB Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
35% identity, 88% coverage: 4:83/91 of query aligns to 2:81/85 of 1j6tB
P0AA04 Phosphocarrier protein HPr; Histidine-containing protein from Escherichia coli (strain K12) (see paper)
35% identity, 88% coverage: 4:83/91 of query aligns to 2:81/85 of P0AA04
P75061 Phosphocarrier protein HPr; Histidine-containing protein from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
33% identity, 86% coverage: 7:84/91 of query aligns to 5:83/88 of P75061
Q9F166 Phosphocarrier protein HPr from Bacillus thuringiensis subsp. israelensis (see 2 papers)
36% identity, 84% coverage: 4:79/91 of query aligns to 1:76/87 of Q9F166
Q9WXK8 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus equinus (Streptococcus bovis) (see paper)
39% identity, 70% coverage: 6:69/91 of query aligns to 4:67/87 of Q9WXK8
>SO3965
MPKLERQVTICNKLGLHARAATKLVVLASEFDASITLIQGEKQASAASVLGLLMLETGMG
KTITLIAEGPDAEPALNAICALIDAKFDEAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory