SitesBLAST
Comparing Synpcc7942_0026 FitnessBrowser__SynE:Synpcc7942_0026 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 92% coverage: 7:306/325 of query aligns to 4:302/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
32% identity, 92% coverage: 7:306/325 of query aligns to 4:302/333 of 1pz1A
- active site: D52 (= D59), Y57 (= Y64), K90 (vs. gap), Q93 (vs. gap), H125 (= H124)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), W21 (= W24), Q175 (= Q180), Y203 (= Y209), G204 (≠ C210), L206 (= L212), R208 (≠ Q214), K214 (= K220), G280 (= G284), R282 (≠ K286), Q286 (= Q290)
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
32% identity, 94% coverage: 9:315/325 of query aligns to 6:322/326 of P77256
- D232 (= D226) mutation D->A,E: Converts the protein into an enzyme with dual specificity, i.e. that is able to use both NADPH and NADH as cosubstrates.
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
31% identity, 94% coverage: 8:313/325 of query aligns to 6:274/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W24), Y59 (= Y64), W87 (≠ F91), H118 (= H124), R204 (≠ Q214)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G22), T21 (= T23), W22 (= W24), Y59 (= Y64), H118 (= H124), N149 (= N156), Q170 (= Q180), Y199 (= Y209), S200 (≠ C210), P201 (= P211), L202 (= L212), R204 (≠ Q214), T205 (≠ G215), Y227 (≠ P266), I243 (= I282), P244 (= P283), K245 (≠ G284), G247 (≠ K286), R248 (≠ S287), H251 (≠ Q290), E254 (≠ D293), N255 (= N294)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
31% identity, 94% coverage: 8:313/325 of query aligns to 6:274/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
31% identity, 94% coverage: 8:313/325 of query aligns to 5:273/274 of 5danA
- active site: D53 (= D59), Y58 (= Y64), K84 (= K89), H117 (= H124)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), T20 (= T23), W21 (= W24), D53 (= D59), Y58 (= Y64), H117 (= H124), Q169 (= Q180), Y198 (= Y209), S199 (≠ C210), P200 (= P211), L201 (= L212), R203 (≠ Q214), Y226 (≠ P266), I242 (= I282), P243 (= P283), K244 (≠ G284), G246 (≠ K286), R247 (≠ S287), H250 (≠ Q290), E253 (≠ D293), N254 (= N294)
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
30% identity, 96% coverage: 7:317/325 of query aligns to 3:311/311 of 1pz0A
- active site: D52 (= D59), Y57 (= Y64), N91 (≠ F91), H124 (= H124)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (= H124), Q174 (= Q180), Y202 (= Y209), F203 (≠ C210), P204 (= P211), L205 (= L212), S207 (≠ Q214), G208 (= G215), A211 (≠ T218), K213 (= K220)
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
30% identity, 94% coverage: 7:313/325 of query aligns to 4:308/310 of P46336
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
31% identity, 94% coverage: 8:312/325 of query aligns to 5:307/337 of Q3L181
- D52 (= D59) mutation to A: 99% loss of activity.
- Y57 (= Y64) mutation to A: 99% loss of activity.
- K84 (= K89) mutation to A: Total loss of activity.
- H126 (= H124) mutation to A: 98% loss of activity.
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 90% coverage: 14:305/325 of query aligns to 2:304/333 of O14295
- S292 (≠ D293) modified: Phosphoserine
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
30% identity, 90% coverage: 8:298/325 of query aligns to 16:294/313 of 6hg6A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G30 (= G22), W32 (= W24), D60 (= D59), Y65 (= Y64), H137 (= H124), Q192 (= Q180), F221 (≠ Y209), S222 (≠ C210), P223 (= P211), L224 (= L212), L278 (vs. gap), I279 (≠ P283), G280 (= G284), Q286 (= Q290), E289 (≠ D293), N290 (= N294)
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
31% identity, 92% coverage: 11:310/325 of query aligns to 11:265/281 of 5c7hA
- active site: D52 (= D59), Y57 (= Y64), K82 (= K89), H115 (= H124)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G22), T23 (= T23), W24 (= W24), D52 (= D59), Y57 (= Y64), H115 (= H124), Q167 (= Q180), Y195 (= Y209), S196 (≠ C210), P197 (= P211), L198 (= L212), E200 (≠ Q214), L204 (≠ T218), A221 (≠ P266), I237 (= I282), P238 (= P283), K239 (≠ G284), T240 (≠ A285), R245 (≠ Q290), E248 (≠ D293), N249 (= N294)
Sites not aligning to the query:
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
31% identity, 92% coverage: 11:310/325 of query aligns to 11:265/281 of 4pmjA
- active site: D52 (= D59), Y57 (= Y64), K82 (= K89), H115 (= H124)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G22), T23 (= T23), W24 (= W24), D52 (= D59), H115 (= H124), Q167 (= Q180), Y195 (= Y209), S196 (≠ C210), P197 (= P211), L198 (= L212), E200 (≠ Q214), L204 (≠ T218), A221 (≠ P266), I237 (= I282), P238 (= P283), K239 (≠ G284), T240 (≠ A285), G241 (≠ K286), R245 (≠ Q290), E248 (≠ D293), N249 (= N294)
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
29% identity, 94% coverage: 8:312/325 of query aligns to 5:275/287 of 3v0sA
- active site: D45 (= D59), Y50 (= Y64), G87 (= G98), H119 (= H124)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (≠ C210), P199 (= P211), I200 (≠ L212), G201 (≠ A213), L204 (= L216), P246 (= P283), G247 (= G284), T248 (≠ A285), T249 (≠ K286), N253 (≠ Q290), N256 (≠ D293), N257 (= N294)
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
29% identity, 89% coverage: 17:305/325 of query aligns to 9:307/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G27), L21 (≠ S29), D49 (= D59), Y54 (= Y64), S151 (= S155), Y204 (= Y209), F205 (≠ C210), L207 (= L212), Q209 (= Q214), G210 (= G215), T213 (= T218), K215 (= K220), R227 (= R233), V284 (= V279), G286 (= G284), Q292 (= Q290), N296 (= N294)
8hw0A The structure of akr6d1
30% identity, 94% coverage: 8:313/325 of query aligns to 5:318/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), W21 (= W24), Q27 (≠ D37), D49 (= D59), Y54 (= Y64), R123 (≠ W125), S152 (= S155), Q178 (= Q180), W207 (≠ Y209), S208 (≠ C210), P209 (= P211), L210 (= L212), S212 (≠ Q214), K218 (= K220), S227 (= S227), R228 (= R228), I285 (= I282), G287 (= G284), S289 (≠ K286), Q293 (= Q290), D296 (= D293), N297 (= N294)
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
33% identity, 90% coverage: 8:298/325 of query aligns to 17:296/315 of 5t79A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G31 (= G22), W33 (= W24), Y66 (= Y64), H138 (= H124), N169 (= N156), Q193 (= Q180), F221 (≠ Y209), S222 (≠ C210), L224 (= L212), G226 (≠ Q214), T230 (= T218), R232 (≠ K220), S263 (≠ P266), L280 (vs. gap), G282 (= G284), S284 (≠ K286), Q288 (= Q290)
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
32% identity, 90% coverage: 8:298/325 of query aligns to 16:291/312 of 3erpA
5az1A Crystal structure of aldo-keto reductase (akr2e5) complexed with nadph (see paper)
29% identity, 95% coverage: 12:320/325 of query aligns to 11:296/327 of 5az1A
- active site: D53 (= D59), Y58 (= Y64), K87 (vs. gap), H120 (= H124)
- binding calcium ion: R79 (≠ T88), L111 (≠ R115), D112 (≠ Q116), H113 (≠ S117)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G22), T22 (= T23), W23 (= W24), D53 (= D59), Y58 (= Y64), H120 (= H124), Q180 (= Q180), Y206 (= Y221), S207 (≠ R222), P208 (= P223), F209 (≠ D224), V213 (≠ R228), S215 (≠ T230), R216 (≠ G231), T243 (≠ P266), I258 (= I282), P259 (= P283), K260 (≠ G284), T261 (≠ A285), V262 (≠ K286), T263 (≠ S287), R266 (≠ Q290), E269 (≠ D293), N270 (= N294)
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
28% identity, 95% coverage: 10:317/325 of query aligns to 17:324/335 of 4aubB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G22), W31 (= W24), D59 (= D59), Y64 (= Y64), H136 (= H124), Q191 (= Q180), F220 (≠ Y209), T221 (≠ C210), P222 (= P211), L223 (= L212), Q225 (= Q214), G226 (= G215), K231 (= K220), R241 (= R233), R244 (≠ N236), L288 (vs. gap), G290 (= G284), S292 (≠ K286), Q296 (= Q290), E299 (≠ D293), N300 (= N294)
Sites not aligning to the query:
Query Sequence
>Synpcc7942_0026 FitnessBrowser__SynE:Synpcc7942_0026
MTIATTCQLGPNGPTVSALGIGTWAWGDSLYWTYGQDYDEAQLQTTFATAIAAGVSFFDT
AEIYGLGESERILGRCLQQGDQPAQIATKYFPIPWRFGSKAVQKALDQSLERLQRQSIEL
YQVHWPPAFLLGQTKILKTLAAAYKRGQIQAIGVSNYNARQLRQAHALLAEQGVPLAVNQ
VQYSLLERRIETNGSLAAARELGVTILAYCPLAQGLLTGKYRPDADSRPTGARKINPQFR
SQALEKLQPLLDQLAALGDRYDRTIPQVALNWLIAQGNVIPIPGAKSPAQAQDNAGALGW
QLSPEDVASLAQLSSGGRSLAAAAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory