SitesBLAST
Comparing Synpcc7942_0027 FitnessBrowser__SynE:Synpcc7942_0027 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12998 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; EC 2.3.1.47 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 90% coverage: 35:383/388 of query aligns to 30:380/384 of P12998
- GF 108:109 (≠ GY 113:114) binding
- H133 (= H138) binding
- S179 (= S185) binding
- H207 (= H213) binding
- T233 (= T238) binding
- K236 (= K241) modified: N6-(pyridoxal phosphate)lysine
- T352 (= T355) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 21 binding
2g6wA Suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine (see paper)
39% identity, 90% coverage: 35:383/388 of query aligns to 29:379/383 of 2g6wA
- active site: N46 (= N52), H132 (= H138), E174 (= E181), S178 (= S185), D203 (= D210), H206 (= H213), K235 (= K241)
- binding (4-{(e)-[(2,2-difluoroethyl)imino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: N46 (= N52), G107 (= G113), H132 (= H138), E174 (= E181), S178 (= S185), D203 (= D210), A205 (= A212), H206 (= H213), K235 (= K241)
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
33% identity, 88% coverage: 46:385/388 of query aligns to 46:391/400 of 7v58B
1djeA Crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase (see paper)
38% identity, 96% coverage: 13:383/388 of query aligns to 6:379/383 of 1djeA
- active site: N46 (= N52), H132 (= H138), E174 (= E181), S178 (= S185), D203 (= D210), H206 (= H213), K235 (= K241)
- binding pyridoxal-5'-phosphate: G107 (= G113), F108 (≠ Y114), H132 (= H138), E174 (= E181), S178 (= S185), D203 (= D210), A205 (= A212), H206 (= H213), T232 (= T238), K235 (= K241)
1dj9A Crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto- 8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). The enzyme of biotin biosynthetic pathway. (see paper)
38% identity, 96% coverage: 13:383/388 of query aligns to 6:379/383 of 1dj9A
- active site: N46 (= N52), H132 (= H138), E174 (= E181), S178 (= S185), D203 (= D210), H206 (= H213), K235 (= K241)
- binding n-[7-keto-8-aminopelargonic acid]-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: R20 (= R29), G107 (= G113), F108 (≠ Y114), H132 (= H138), E174 (= E181), D203 (= D210), A205 (= A212), H206 (= H213), T232 (= T238), K235 (= K241), I347 (= I351), T351 (= T355)
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
31% identity, 93% coverage: 26:385/388 of query aligns to 22:388/396 of 3tqxA
- active site: N48 (= N52), H134 (= H138), D179 (≠ E181), S183 (= S185), D208 (= D210), H211 (= H213), K242 (= K241)
- binding pyridoxal-5'-phosphate: S108 (= S112), C109 (≠ G113), F110 (≠ Y114), H134 (= H138), D208 (= D210), S210 (≠ A212), H211 (= H213), T239 (= T238), K242 (= K241), F271 (≠ Y269), S272 (≠ T270), N273 (≠ T271)
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
34% identity, 87% coverage: 46:384/388 of query aligns to 47:391/401 of 1fc4A
- active site: N53 (= N52), H139 (= H138), D184 (≠ E181), S188 (= S185), D213 (= D210), H216 (= H213), K247 (= K241)
- binding 2-amino-3-ketobutyric acid: N53 (= N52), H139 (= H138), S188 (= S185), H216 (= H213), K247 (= K241), R371 (= R364)
- binding pyridoxal-5'-phosphate: S113 (= S112), C114 (≠ G113), F115 (≠ Y114), H139 (= H138), S188 (= S185), D213 (= D210), S215 (≠ A212), H216 (= H213), T244 (= T238), K247 (= K241), F276 (≠ Y269), S277 (≠ T270), N278 (≠ T271)
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
34% identity, 87% coverage: 46:384/388 of query aligns to 44:388/398 of P0AB77
- H136 (= H138) binding
- S185 (= S185) binding in other chain
- R368 (= R364) binding
6hrhA Structure of human erythroid-specific 5'-aminolevulinate synthase, alas2
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 6hrhA
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), H218 (= H213), T246 (= T238), K249 (= K241), T278 (= T270), T279 (= T271)
5qreA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z117233350
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qreA
- binding pyridoxal-5'-phosphate: C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), T246 (= T238), K249 (= K241), T278 (= T270), T279 (= T271)
Sites not aligning to the query:
5qrcA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31721798
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qrcA
- binding 3-cyclohexyl-1-(morpholin-4-yl)propan-1-one: K129 (≠ D126), I130 (vs. gap), Y271 (≠ T263)
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), K249 (= K241), T278 (= T270), T279 (= T271)
5qraA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1101755952
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qraA
- binding [(4R)-4-methyl-2,3,4,5-tetrahydro-1H-azepin-1-yl](1,3-thiazol-4-yl)methanone: K129 (≠ D126), I130 (vs. gap), Y271 (≠ T263)
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), T246 (= T238), K249 (= K241), T278 (= T270), T279 (= T271)
5qr9A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31478129
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qr9A
- binding ethyl benzylcarbamate: H206 (≠ D201), L211 (≠ I206), D241 (= D233)
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), K249 (= K241), T278 (= T270), T279 (= T271)
5qr3A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z915492990
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qr3A
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), K249 (= K241), T278 (= T270), T279 (= T271)
Sites not aligning to the query:
5qr1A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z396380540
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qr1A
- binding ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-carboxamide: I130 (vs. gap), Y271 (≠ T263)
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), T246 (= T238), K249 (= K241), T278 (= T270), T279 (= T271)
5qr0A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z730649594
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qr0A
- binding N-[2-(4-hydroxyphenyl)ethyl]pyridine-2-carboxamide: H206 (≠ D201), L211 (≠ I206), D241 (= D233), T261 (≠ S253), L264 (= L256), E300 (= E292), A303 (vs. gap), A307 (≠ H297), P380 (≠ S369), H381 (≠ D370)
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), K249 (= K241), T278 (= T270), T279 (= T271)
5qqyA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434899
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qqyA
- binding 1-[(2,5-dihydrothiophen-3-yl)methyl]piperidin-4-ol: K16 (≠ E15), E19 (≠ Q18), K129 (≠ D126), Y271 (≠ T263)
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), T246 (= T238), K249 (= K241), T278 (= T270), T279 (= T271)
Sites not aligning to the query:
5qqxA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z373768900
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qqxA
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), K249 (= K241), T278 (= T270), T279 (= T271)
Sites not aligning to the query:
5qqwA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z136583524
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qqwA
- binding 2-methyl-N-(pyridin-4-yl)furan-3-carboxamide: F125 (≠ P122), T126 (= T123), K129 (≠ D126)
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), T246 (= T238), K249 (= K241), T278 (= T270), T279 (= T271)
5qquA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1348371854
33% identity, 97% coverage: 12:388/388 of query aligns to 13:399/429 of 5qquA
- binding 5-(1,4-oxazepan-4-yl)pyridine-2-carbonitrile: Q65 (≠ R62), Q68 (≠ A65), R151 (≠ Q146), N152 (≠ A147), G154 (≠ K149)
- binding pyridoxal-5'-phosphate: S115 (= S112), C116 (≠ G113), F117 (≠ Y114), H143 (= H138), E186 (= E181), S190 (= S185), D215 (= D210), V217 (≠ A212), H218 (= H213), T246 (= T238), K249 (= K241), T278 (= T270), T279 (= T271)
Query Sequence
>Synpcc7942_0027 FitnessBrowser__SynE:Synpcc7942_0027
MVSDRGVAKWAFVEEAFQKRGPSNRRSLREFSPEAGPYLRQGDRPLLDFSSNDYLGLAQD
PRLIAAATAAMRRYGTGAMASRLVCGSFPLHQQLEEALAAFSQREAALLFSSGYQANATL
LPTLFDRQSLVLVDRLAHNSLLFGVQASKAQWRRYRHNDFDHLEQLLQQAPAGVRLGIVS
ETVFSMDGDRTDVDRLADLADRYGAILYLDDAHALGVLGTEGSGLALRHPRVDVAVGTFG
KACGSAGAFVVASRSLCDYWINTCPGLIYTTAIAPPVVAAALAAVQLLPELEPERQHLQA
IAAELRQSCRDRGWDCGPSETQIVPLLVGESEQALALAQRLEAAGILAIAIRPPTVPEGT
ARLRLVLRSDHQPQHLHQLVTVLSEGWV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory