SitesBLAST
Comparing Synpcc7942_0031 FitnessBrowser__SynE:Synpcc7942_0031 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:421/427 of 4cxqA
- active site: Y18 (≠ F11), Y149 (= Y138), E212 (= E206), D246 (= D240), A249 (≠ M243), K275 (= K269), Y399 (= Y398)
- binding 7-keto-8-aminopelargonic acid: W56 (= W46), Y149 (= Y138), G308 (= G303), T310 (≠ S305), R392 (= R391)
- binding pyridoxal-5'-phosphate: G116 (= G106), S117 (= S107), Y149 (= Y138), H150 (= H139), G151 (= G140), E212 (= E206), D246 (= D240), I248 (≠ V242), K275 (= K269), P309 (≠ H304), T310 (≠ S305)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
39% identity, 100% coverage: 3:424/424 of query aligns to 9:443/448 of 3du4A
- active site: F17 (= F11), Y146 (= Y138), E217 (= E206), D251 (= D240), A254 (≠ M243), K280 (= K269), A417 (≠ Y398)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A75), Y146 (= Y138), G315 (= G303), S317 (= S305), R410 (= R391)
- binding pyridoxal-5'-phosphate: S112 (≠ N105), G113 (= G106), A114 (≠ S107), Y146 (= Y138), H147 (= H139), E217 (= E206), D251 (= D240), V253 (= V242), A254 (≠ M243), K280 (= K269), H316 (= H304), S317 (= S305)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
39% identity, 100% coverage: 3:424/424 of query aligns to 9:443/448 of P53555
- GA 113:114 (≠ GS 106:107) binding
- Y146 (= Y138) binding
- K280 (= K269) modified: N6-(pyridoxal phosphate)lysine
- G315 (= G303) binding
- HS 316:317 (= HS 304:305) binding
- R410 (= R391) binding
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:419/425 of 4w1vA
- active site: Y18 (≠ F11), Y147 (= Y138), E210 (= E206), D244 (= D240), A247 (≠ M243), K273 (= K269), Y397 (= Y398)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P10), Y18 (≠ F11), W54 (= W46), M81 (≠ I73), G83 (≠ A75), Y147 (= Y138), G306 (= G303), P307 (≠ H304), T308 (≠ S305), F392 (≠ L393)
- binding pyridoxal-5'-phosphate: G114 (= G106), S115 (= S107), Y147 (= Y138), H148 (= H139), E210 (= E206), D244 (= D240), I246 (≠ V242), K273 (= K269)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:419/425 of 4cxrA
- active site: Y18 (≠ F11), Y147 (= Y138), E210 (= E206), D244 (= D240), A247 (≠ M243), K273 (= K269), Y397 (= Y398)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ F11), W54 (= W46), W55 (= W47), A216 (= A212)
- binding pyridoxal-5'-phosphate: G114 (= G106), S115 (= S107), Y147 (= Y138), H148 (= H139), E210 (= E206), D244 (= D240), I246 (≠ V242), K273 (= K269), P307 (≠ H304), T308 (≠ S305)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 20:429/437 of P9WQ81
- Y25 (≠ F11) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (= W46) binding
- Y157 (= Y138) binding
- K283 (= K269) modified: N6-(pyridoxal phosphate)lysine
- G316 (= G303) binding
4wydA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase from mycobacterium tuberculosis complexed with a fragment from dsf screening (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/430 of 4wydA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding N-methyl-1-[4-(1H-pyrazol-1-ylmethyl)phenyl]methanamine: Y18 (≠ F11), W57 (= W46), W58 (= W47), Y150 (= Y138), A219 (= A212), G309 (= G303), T311 (≠ S305), F395 (≠ L393)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 5kgtA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (≠ I73), G86 (≠ A75), G309 (= G303), T311 (≠ S305)
- binding pyridoxal-5'-phosphate: S116 (≠ N105), G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269)
5kgsA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 5kgsA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2,3-dihydroinden-1-one: P17 (= P10), Y18 (≠ F11), W57 (= W46), M84 (≠ I73), G86 (≠ A75), Y150 (= Y138), D162 (≠ E150), G165 (≠ S152), G166 (≠ L153), P310 (≠ H304), T311 (≠ S305), F395 (≠ L393)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269)
4xjpA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 4xjpA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 1-{4-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]phenyl}ethanone: P17 (= P10), Y18 (≠ F11), W57 (= W46), M84 (≠ I73), G86 (≠ A75), Y150 (= Y138), G165 (≠ S152), G166 (≠ L153), A219 (= A212), G220 (= G213), G309 (= G303), F395 (≠ L393)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
4xjmA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 4xjmA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 3-{1-[(5-acetylthiophen-2-yl)carbonyl]piperidin-4-yl}-N-(3-methoxyphenyl)propanamide: P17 (= P10), Y18 (≠ F11), W57 (= W46), M84 (≠ I73), G86 (≠ A75), Y150 (= Y138), M158 (= M146), G165 (≠ S152), G166 (≠ L153), M167 (≠ F154), W171 (≠ F158), M307 (≠ Y301), G309 (= G303), T311 (≠ S305)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
4xjlA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 4xjlA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding N-(1,2,3-benzothiadiazol-5-yl)-4-phenylpiperazine-1-carboxamide: P17 (= P10), Y18 (≠ F11), W57 (= W46), M84 (≠ I73), G86 (≠ A75), Y150 (= Y138), C161 (≠ G149), G165 (≠ S152), G166 (≠ L153), A219 (= A212)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
4wygA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a fragment hit (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 4wygA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 1-{4-[(4-chloro-1H-pyrazol-1-yl)methyl]phenyl}methanamine: Y18 (≠ F11), W57 (= W46), W58 (= W47), Y150 (= Y138), A219 (= A212), F395 (≠ L393)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
4wyeA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a dsf fragment hit (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 4wyeA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding phenyl(piperidin-4-yl)methanone: Y18 (≠ F11), W57 (= W46), W58 (= W47), A219 (= A212), F395 (≠ L393), Y400 (= Y398)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
4w1xA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 1-(4-(4-(3-chlorobenzoyl) piperazin-1-yl)phenyl)ethanone (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 4w1xA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 1-{4-[4-(3-chlorobenzoyl)piperazin-1-yl]phenyl}ethanone: P17 (= P10), Y18 (≠ F11), W57 (= W46), M84 (≠ I73), G86 (≠ A75), Y150 (= Y138), G165 (≠ S152), G166 (≠ L153), A219 (= A212), G309 (= G303), T311 (≠ S305)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
4w1wA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 7-(diethylamino)-3- (thiophene-2-carbonyl)-2h-chromen-2-one (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/429 of 4w1wA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 7-(diethylamino)-3-(thiophen-2-ylcarbonyl)-2H-chromen-2-one: P17 (= P10), Y18 (≠ F11), W57 (= W46), M84 (≠ I73), G86 (≠ A75), Y150 (= Y138), G165 (≠ S152), G309 (= G303), P310 (≠ H304), R393 (= R391)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
5te2A Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a mechanism-based inhibitor (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/428 of 5te2A
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-4-oxo-1,4-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: Y18 (≠ F11), W57 (= W46), G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), D247 (= D240), I249 (≠ V242), K276 (= K269), G309 (= G303), P310 (≠ H304), T311 (≠ S305)
4xjoA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/428 of 4xjoA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 5-[4-(3-chlorobenzoyl)piperazin-1-yl]-1H-inden-1-one: P17 (= P10), Y18 (≠ F11), W57 (= W46), M84 (≠ I73), G86 (≠ A75), Y150 (= Y138), G165 (≠ S152), G166 (≠ L153), A219 (= A212), P310 (≠ H304), T311 (≠ S305)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
4xewA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/428 of 4xewA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding 6-(2-fluorophenyl)[1,3]dioxolo[4,5-g]quinolin-8(5H)-one: P17 (= P10), Y18 (≠ F11), W57 (= W46), Y150 (= Y138), P310 (≠ H304), T311 (≠ S305), R393 (= R391), F395 (≠ L393)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
4wyfA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a dsf fragment hit (see paper)
41% identity, 98% coverage: 6:420/424 of query aligns to 13:422/428 of 4wyfA
- active site: Y18 (≠ F11), Y150 (= Y138), E213 (= E206), D247 (= D240), A250 (≠ M243), K276 (= K269), Y400 (= Y398)
- binding N-(1-oxo-1H-inden-5-yl)acetamide: M84 (≠ I73), G86 (≠ A75), G309 (= G303), P310 (≠ H304), T311 (≠ S305)
- binding pyridoxal-5'-phosphate: G117 (= G106), S118 (= S107), Y150 (= Y138), H151 (= H139), G152 (= G140), E213 (= E206), D247 (= D240), I249 (≠ V242), K276 (= K269), P310 (≠ H304), T311 (≠ S305)
Query Sequence
>Synpcc7942_0031 FitnessBrowser__SynE:Synpcc7942_0031
MPSHPHLWFPFTSVKDAPDPLKVVSGKGARLTLADGRELIDCISSWWVNLHGHAHLRIVE
AIAQQAATLEHVIFAGFSHEPAERLAMELCKILPEKLTRVFFSDNGSTAVEVALKMALQY
WHNLDQPRSRILAFDGAYHGDTFGAMSVGERSLFNAPFEKLLFSVEFLPYPETWWGDETV
EAKEAAAIAAVEQALAAGDVAAVIIEPLVQGAGGMRMARPQFLQQLAARVQAAGSLLIAD
EVMTGFGRTGAWFACQRAGIQPDLICLSKGLTGGFLPLSITVATEVIYDTFCSGNPDHTF
YHGHSYTANPLGCAAAIASLELLLDSEAIVQGLEDAHLPGLELLAQHPKVTRPRLTGGIA
ACDLVSDRGGYLDPIGLRVRQAAIARGLLLRPLGNVLYLLPPYCLTPTELQDIYAAIADL
LDEI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory