SitesBLAST
Comparing Synpcc7942_0061 FitnessBrowser__SynE:Synpcc7942_0061 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rkxC Crystal structure at 1.8 angstrom of cdp-d-glucose 4,6-dehydratase from yersinia pseudotuberculosis (see paper)
43% identity, 99% coverage: 1:366/368 of query aligns to 1:347/351 of 1rkxC
- active site: T130 (= T137), S131 (≠ T138), D132 (= D139), K133 (= K140), Y156 (= Y163), K160 (= K167)
- binding nicotinamide-adenine-dinucleotide: G15 (= G15), T17 (= T17), G18 (= G18), F19 (= F19), K20 (= K20), S39 (≠ A39), L40 (= L40), D64 (≠ E71), I65 (≠ M72), M86 (≠ L93), A87 (= A94), A88 (= A95), P90 (= P97), T105 (= T112), I129 (≠ V136), S131 (≠ T138), Y156 (= Y163), K160 (= K167), A192 (= A199), V195 (= V202)
1wvgA Structure of cdp-d-glucose 4,6-dehydratase from salmonella typhi (see paper)
44% identity, 94% coverage: 1:346/368 of query aligns to 2:330/352 of 1wvgA
- binding adenosine-5-diphosphoribose: G16 (= G15), T18 (= T17), G19 (= G18), F20 (= F19), K21 (= K20), A40 (= A39), L41 (= L40), D65 (≠ E71), I66 (≠ M72), M87 (≠ L93), A88 (= A94), A89 (= A95), P91 (= P97), I130 (≠ V136), K161 (= K167), R206 (= R212)
- binding cytidine-5'-diphospho-beta-d-xylose: P91 (= P97), K134 (= K140), Y157 (= Y163), N195 (= N201), D205 (= D211), R206 (= R212), L207 (≠ I213), D210 (= D216), I222 (≠ A228), R224 (= R230), N225 (= N231), S228 (= S234), R230 (= R236), E295 (= E311)
7us5A X-ray crystal structure of gdp-d-glycero-d-manno-heptose 4,6- dehydratase from campylobacter jejuni (see paper)
25% identity, 87% coverage: 9:329/368 of query aligns to 5:317/346 of 7us5A
- binding guanosine-5'-diphosphate: P92 (≠ V99), E137 (≠ K140), V198 (≠ W208), F199 (≠ A209), F200 (≠ V210), G223 (≠ R230), N224 (= N231), S227 (= S234), R229 (= R236), L269 (≠ V285), R294 (≠ P306), R296 (≠ A308), D299 (≠ E311)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), T13 (= T17), G14 (= G18), Q15 (≠ F19), V16 (≠ K20), R37 (≠ L40), E40 (= E43), D64 (≠ E71), L65 (≠ M72), L86 (= L93), A87 (= A94), A88 (= A95), S90 (≠ P97), T105 (= T112), C133 (≠ V136), Y160 (= Y163), K164 (= K167), H190 (≠ R198), R195 (≠ G205)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 92% coverage: 9:345/368 of query aligns to 2:331/355 of P27830
- FI 12:13 (≠ FK 19:20) binding
- DKLT 33:36 (≠ --WG 36:37) binding
- DI 59:60 (≠ DL 53:54) binding
- T100 (= T112) binding
- D135 (= D139) active site, Proton donor
- E136 (≠ K140) active site, Proton acceptor
- Y160 (= Y163) active site, Proton acceptor
- YSASK 160:164 (= YSASK 163:167) binding
- N190 (≠ V202) binding
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
25% identity, 92% coverage: 10:348/368 of query aligns to 2:312/313 of 6bwlA
- active site: T122 (= T138), C123 (≠ D139), M124 (≠ K140), Y147 (= Y163), K151 (= K167)
- binding nicotinamide-adenine-dinucleotide: G7 (= G15), G10 (= G18), F11 (= F19), I12 (≠ K20), D31 (= D53), N32 (vs. gap), L33 (= L54), N35 (= N56), S36 (≠ Q57), D57 (≠ E71), I58 (≠ M72), L79 (= L93), A80 (= A94), A81 (= A95), I83 (≠ P97), M120 (≠ V136), K151 (= K167), N176 (= N201), T177 (≠ V202)
- binding uridine-5'-diphosphate: N176 (= N201), G189 (≠ A209), V190 (= V210), N205 (≠ Q239), I206 (≠ L245), Y207 (≠ G246), Q212 (≠ L251), R214 (≠ Q253), I250 (= I289), E275 (= E311)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
24% identity, 91% coverage: 10:345/368 of query aligns to 3:306/329 of 2hunA
- active site: T125 (= T138), D126 (= D139), E127 (≠ K140), Y149 (= Y163), K153 (= K167)
- binding nicotinamide-adenine-dinucleotide: G8 (= G15), G11 (= G18), F12 (= F19), I13 (≠ K20), D34 (= D34), K35 (≠ V35), S40 (≠ L40), D60 (≠ E71), V61 (≠ M72), L80 (= L93), A81 (= A94), A82 (= A95), S99 (≠ T112), T125 (= T138), K153 (= K167), C176 (≠ A199), T177 (≠ G200), N178 (= N201), N179 (≠ V202)
1orrA Crystal structure of cdp-tyvelose 2-epimerase complexed with NAD and cdp (see paper)
29% identity, 44% coverage: 10:171/368 of query aligns to 2:172/338 of 1orrA
- active site: T124 (= T138), N125 (≠ D139), K126 (= K140), Y164 (= Y163), K168 (= K167)
- binding cytidine-5'-diphosphate: K126 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G15), G10 (= G18), F11 (= F19), L12 (≠ K20), D31 (≠ P41), N32 (≠ P42), S34 (= S44), R35 (≠ E45), D57 (≠ E71), I58 (≠ M72), L79 (= L93), V83 (≠ P97), S122 (≠ V136), Y164 (= Y163), K168 (= K167)
Sites not aligning to the query:
- binding cytidine-5'-diphosphate: 193, 203, 207, 210, 211, 229, 234, 236, 298, 301
- binding nicotinamide-adenine-dinucleotide: 191, 194, 205
P14169 CDP-paratose 2-epimerase; CDP-tyvelose 2-epimerase; EC 5.1.3.10 from Salmonella typhi (see paper)
29% identity, 44% coverage: 10:171/368 of query aligns to 2:172/338 of P14169
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
22% identity, 92% coverage: 9:345/368 of query aligns to 4:337/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G15), G13 (= G18), F14 (= F19), I15 (≠ K20), D36 (≠ R46), A37 (≠ S47), L38 (= L48), T39 (≠ F49), G42 (≠ L52), D62 (≠ E71), I63 (≠ M72), L84 (= L93), A85 (= A94), A86 (= A95), T103 (= T112), S143 (≠ T137), T144 (= T138), Y169 (= Y163), K173 (= K167), C196 (≠ A199)
P93031 GDP-mannose 4,6 dehydratase 2; GDP-D-mannose dehydratase 2; GMD 2; EC 4.2.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 93% coverage: 2:342/368 of query aligns to 21:348/373 of P93031
- GITGQD 35:40 (≠ GHTGFK 15:20) binding
- R60 (≠ L40) binding
- DL 91:92 (≠ EM 71:72) binding
- P107 (= P87) mutation to L: In mur1-2; strong reduction in L-fucose in the cell walls.
- LAAQS 113:117 (≠ LAAQP 93:97) binding
- Y128 (≠ G108) binding
- R139 (≠ Q119) mutation to C: In mur1-7; strong reduction in L-fucose in the cell walls.
- R153 (≠ T137) mutation to C: In mur1-5; strong reduction in L-fucose in the cell walls.
- S162 (≠ R145) mutation to F: In mur1-1; strong reduction in L-fucose in the cell walls.
- K189 (= K167) binding
- A191 (= A169) mutation to V: In mur1-3; strong reduction in L-fucose in the cell walls.
- A202 (≠ S180) mutation to V: In mur1-6; strong reduction in L-fucose in the cell walls.
- G210 (≠ Q188) mutation to Q: In mur1-4; strong reduction in L-fucose in the cell walls.
- H215 (≠ A193) binding
- R220 (= R198) binding
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
25% identity, 92% coverage: 9:345/368 of query aligns to 2:325/344 of 1bxkB
- active site: S125 (≠ H129), T134 (= T138), D135 (= D139), E136 (≠ K140), S158 (≠ D161), Y160 (= Y163), S161 (= S164), K164 (= K167)
- binding nicotinamide-adenine-dinucleotide: G8 (= G15), G11 (= G18), F12 (= F19), I13 (≠ K20), D33 (vs. gap), K34 (vs. gap), L35 (≠ W36), T36 (≠ G37), A38 (= A39), G39 (vs. gap), D59 (= D53), I60 (≠ L54), L81 (= L93), A83 (= A95), T100 (= T112), I132 (≠ V136), S133 (≠ T137), T134 (= T138), K164 (= K167), C187 (≠ A199)
1n7gB Crystal structure of the gdp-mannose 4,6-dehydratase ternary complex with NADPH and gdp-rhamnose. (see paper)
24% identity, 90% coverage: 12:342/368 of query aligns to 5:316/336 of 1n7gB
- active site: S130 (≠ R145), S131 (≠ E146), E132 (≠ W147), Y153 (= Y163), K157 (= K167)
- binding guanosine-5'-diphosphate-rhamnose: S85 (≠ P97), H86 (≠ L98), S130 (≠ R145), Y153 (= Y163), N182 (≠ L192), R188 (= R198), F192 (≠ V202), V193 (= V210), G215 (≠ R230), N216 (= N231), R221 (= R236), R282 (vs. gap), E285 (= E311)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), T10 (= T17), G11 (= G18), Q12 (≠ F19), D13 (≠ K20), R33 (≠ E45), R34 (= R46), S35 (= S47), S36 (≠ L48), D59 (≠ E71), L60 (≠ M72), L81 (= L93), A82 (= A94), A83 (= A95), S85 (≠ P97), V100 (≠ T112), A128 (vs. gap), G129 (≠ N144), S130 (≠ R145), Y153 (= Y163), K157 (= K167), N182 (≠ L192), H183 (≠ A193), R188 (= R198)
1n7hA Crystal structure of gdp-mannose 4,6-dehydratase ternary complex with NADPH and gdp (see paper)
24% identity, 90% coverage: 12:342/368 of query aligns to 5:313/331 of 1n7hA
- active site: S127 (≠ R145), S128 (≠ E146), E129 (≠ W147), Y150 (= Y163), K154 (= K167)
- binding guanosine-5'-diphosphate: N179 (≠ L192), F189 (≠ V202), V190 (= V210), K193 (≠ I213), L211 (≠ V229), G212 (≠ R230), N213 (= N231), R218 (= R236), R279 (vs. gap), E282 (= E311)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), T10 (= T17), G11 (= G18), Q12 (≠ F19), D13 (≠ K20), R33 (≠ F49), D56 (≠ E71), L57 (≠ M72), L78 (= L93), A79 (= A94), A80 (= A95), S82 (≠ P97), A125 (vs. gap), G126 (≠ N144), S127 (≠ R145), Y150 (= Y163), K154 (= K167), L177 (≠ P190), N179 (≠ L192), H180 (≠ A193), R185 (= R198)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
23% identity, 94% coverage: 1:345/368 of query aligns to 1:321/667 of Q9LPG6
- G18 (= G18) mutation to A: Abolishes dehydratase activity.
- K36 (≠ W36) mutation to A: Reduces dehydratase activity.
- D96 (≠ R100) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K167) mutation to A: Abolishes dehydratase activity.
- G193 (= G204) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
22% identity, 92% coverage: 6:345/368 of query aligns to 4:319/669 of Q9SYM5
- R283 (≠ W296) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
2pk3A Crystal structure of a gdp-4-keto-6-deoxy-d-mannose reductase (see paper)
22% identity, 91% coverage: 12:346/368 of query aligns to 4:307/309 of 2pk3A
- active site: S114 (≠ T138), S115 (≠ D139), E116 (≠ K140), Y140 (= Y163), K144 (= K167)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G10 (= G18), F11 (= F19), V12 (≠ K20), R32 (≠ L40), D47 (≠ E71), I48 (≠ M72), L69 (= L93), A70 (= A94), A71 (= A95), S73 (≠ P97), I112 (≠ V136), Y140 (= Y163), K144 (= K167), H170 (≠ A193)
- binding guanosine-5'-diphosphate-alpha-d-mannose: S73 (≠ P97), V75 (= V99), S114 (≠ T138), S115 (≠ D139), Y140 (= Y163), F168 (≠ Y191), N169 (≠ L192), G178 (≠ N201), F179 (≠ V202), V180 (≠ I203), D183 (= D207), F184 (≠ W208), G203 (≠ R230), N204 (= N231), R209 (= R236), I244 (= I279), Q267 (≠ A308), R269 (vs. gap), E272 (= E311)
Q6T1X6 GDP-6-deoxy-D-mannose reductase; EC 1.1.1.281 from Aneurinibacillus thermoaerophilus (see paper)
22% identity, 91% coverage: 12:346/368 of query aligns to 4:307/309 of Q6T1X6
- N169 (≠ L192) binding
- D183 (= D207) binding
- R209 (= R236) binding
Q51366 GDP-mannose 4,6-dehydratase; GDP-D-mannose dehydratase; EC 4.2.1.47 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
25% identity, 91% coverage: 9:343/368 of query aligns to 3:314/323 of Q51366
1rpnD Crystal structure of gdp-d-mannose 4,6-dehydratase in complexes with gdp and NADPH (see paper)
25% identity, 91% coverage: 9:343/368 of query aligns to 2:313/322 of 1rpnD
- active site: T125 (= T138), S126 (≠ D139), E127 (≠ K140), Y149 (= Y163), K153 (= K167)
- binding guanosine-5'-diphosphate: F85 (≠ L98), E127 (≠ K140), N178 (vs. gap), E187 (≠ A195), F188 (≠ T196), V189 (= V210), K192 (≠ I213), L210 (vs. gap), G211 (vs. gap), N212 (= N231), A215 (≠ S234), R217 (= R236), F276 (vs. gap), R278 (≠ A308), E281 (= E311)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), T10 (= T17), G11 (= G18), Q12 (≠ F19), D13 (≠ K20), R34 (≠ E45), R35 (= R46), S36 (= S47), D58 (≠ E71), M59 (= M72), L80 (= L93), A81 (= A94), A82 (= A95), S84 (≠ P97), A123 (≠ V136), S124 (≠ T137), T125 (= T138), Y149 (= Y163), K153 (= K167), L176 (vs. gap), N178 (vs. gap), H179 (= H187), R184 (≠ L192)
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
24% identity, 91% coverage: 10:345/368 of query aligns to 2:334/361 of 1kewA
- active site: T133 (= T138), D134 (= D139), E135 (≠ K140), L152 (≠ V148), L154 (≠ G150), F155 (≠ Y151), T158 (= T154), Y167 (= Y163), K171 (= K167)
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), F11 (= F19), I12 (≠ K20), D32 (≠ L40), K33 (≠ P41), L34 (≠ P42), T35 (≠ E43), A37 (≠ E45), G38 (≠ R46), D58 (≠ E71), I59 (≠ M72), L80 (= L93), A81 (= A94), A82 (= A95), S84 (≠ P97), T99 (= T112), I131 (≠ V136), S132 (≠ T137), T133 (= T138), Y167 (= Y163), K171 (= K167), C194 (= C182), N196 (≠ D184), N197 (≠ H187)
- binding thymidine-5'-diphosphate: E135 (≠ K140), N196 (≠ D184), K206 (vs. gap), L207 (vs. gap), P222 (vs. gap), Y224 (≠ I203), R231 (≠ V210), N266 (≠ E263), R297 (≠ H295), H300 (≠ Q299)
Sites not aligning to the query:
Query Sequence
>Synpcc7942_0061 FitnessBrowser__SynE:Synpcc7942_0061
MNSSFWRDRQVLITGHTGFKGSWLTLWLLMQGADVWGYALPPESERSLFTALDLANQRQA
GWGYFQYRLGEMNDAEALRQWVEQAQPEVVFHLAAQPLVRRSYADPLGTWQTNVLGSLQL
LEALKSLQHPCAMVMVTTDKVYENREWVYGYRETDCLGGHDPYSASKAAMELAVASWRSS
FCGDAAHQTPYLAIATARAGNVIGGGDWAVDRIVPDAVRSLSAGAAIAVRNSHSTRPWQH
VLEPLGGYLLLAQRLLEHQQSAEKTVNPFARAFNFGPAIESNRSVKELITTVLQHWPGQW
VDQSDPTAPHEAGLLHLVSDQARQLLGWQPRWDFETTVSRTIHWYRPVMMTGGSALEACL
EDLATYGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory