Comparing Synpcc7942_0116 FitnessBrowser__SynE:Synpcc7942_0116 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 93% coverage: 24:323/324 of query aligns to 16:309/319 of Q8ZKR2
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
31% identity, 92% coverage: 24:321/324 of query aligns to 13:305/306 of 5eynA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
30% identity, 92% coverage: 24:321/324 of query aligns to 17:309/310 of 5yggA
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
30% identity, 98% coverage: 7:323/324 of query aligns to 4:319/322 of 3lkiB
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
26% identity, 98% coverage: 8:323/324 of query aligns to 4:307/308 of 3iq0B
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
30% identity, 93% coverage: 24:323/324 of query aligns to 12:298/299 of 1tz3A
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
30% identity, 92% coverage: 24:322/324 of query aligns to 12:297/297 of 1tz6A
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 89% coverage: 36:324/324 of query aligns to 31:304/309 of Q53W83
8cqxA Ribokinase from t.Sp mutant a92g
30% identity, 97% coverage: 8:321/324 of query aligns to 2:298/300 of 8cqxA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
29% identity, 88% coverage: 36:321/324 of query aligns to 31:301/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
29% identity, 88% coverage: 36:320/324 of query aligns to 31:300/300 of 1v1bA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 82% coverage: 8:272/324 of query aligns to 3:254/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
27% identity, 82% coverage: 8:272/324 of query aligns to 2:253/302 of 3gbuA
Sites not aligning to the query:
6znxC Ribokinase from thermus species
31% identity, 90% coverage: 31:321/324 of query aligns to 16:263/265 of 6znxC
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
26% identity, 97% coverage: 8:322/324 of query aligns to 4:295/298 of 7agkA
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
26% identity, 97% coverage: 8:322/324 of query aligns to 4:295/298 of P32143
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
26% identity, 97% coverage: 8:322/324 of query aligns to 4:295/302 of 7ag6A
7fcaD Pfkb(mycobacterium marinum) (see paper)
29% identity, 92% coverage: 9:307/324 of query aligns to 5:282/282 of 7fcaD
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
27% identity, 97% coverage: 8:322/324 of query aligns to 4:293/295 of 7aghA
Q9M394 Fructokinase-like 1, chloroplastic; PEP-associated protein 6; pfkB-type carbohydrate kinase family protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
22% identity, 88% coverage: 37:320/324 of query aligns to 147:461/471 of Q9M394
Sites not aligning to the query:
>Synpcc7942_0116 FitnessBrowser__SynE:Synpcc7942_0116
MTAQAPTVICLGEMLWDCLANDRDLPAEQVQSWTPWPGGAPANVATALVKLGVQSGLITC
LGSDPEGDRLFQVLQDNGVAIAAVQRHPRLPTRQVQVLRTAQGDRQFGGFGAIACDQFAD
TELQAEQLPQAWFRLAKVLCLGTIPLAYPSSAIAAQQALTWANQQGMTVLLDVNWRPSFW
PDPSLAPDRIRAILPQIQQLKLAREEAEWLFDTVDPATIQARQPQLQAVLITDGDRGCHY
WVAGWQGHCPSFPVKAIDTTGAGDAFVAAWLAQNTQMDFQWTSAEQVQTAIRWASAAGAL
TTLNPGAIAAQPTSDAIQSLLSKT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory