Comparing Synpcc7942_0150 FitnessBrowser__SynE:Synpcc7942_0150 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q8U4M3 Dolichol-phosphate mannosyltransferase; Dolichol-phosphate mannose synthase; DPM synthase; Dolichyl-phosphate beta-D-mannosyltransferase; Mannose-P-dolichol synthase; MPD synthase; PfDPMS; EC 2.4.1.83 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
39% identity, 93% coverage: 26:386/388 of query aligns to 3:350/352 of Q8U4M3
5mm0A Dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) (see paper)
39% identity, 93% coverage: 26:386/388 of query aligns to 6:353/355 of 5mm0A
5mlzA Dolichyl phosphate mannose synthase in complex with gdp and mg2+ (see paper)
39% identity, 93% coverage: 26:386/388 of query aligns to 6:353/355 of 5mlzA
5mm1A Dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose (see paper)
38% identity, 93% coverage: 26:386/388 of query aligns to 2:344/346 of 5mm1A
P14020 Dolichol-phosphate mannosyltransferase; Dolichol-phosphate mannose synthase; DPM synthase; Dolichyl-phosphate beta-D-mannosyltransferase; Mannose-P-dolichol synthase; MPD synthase; EC 2.4.1.83 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 62% coverage: 27:266/388 of query aligns to 6:248/267 of P14020
Sites not aligning to the query:
5ekeC Structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) (see paper)
33% identity, 32% coverage: 26:149/388 of query aligns to 9:131/307 of 5ekeC
P74165 Beta-monoglucosyldiacylglycerol synthase; Beta-MGS; MGlcDAG synthase; UDP-glucose:1,2-diacylglycerol 3-beta-D-glucosyltransferase; EC 2.4.1.336 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
33% identity, 27% coverage: 24:126/388 of query aligns to 108:210/479 of P74165
Sites not aligning to the query:
D4GUA0 Glycosyltransferase AglD; Archaeal glycosylation protein D; EC 2.4.1.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
29% identity, 31% coverage: 26:144/388 of query aligns to 19:139/624 of D4GUA0
Sites not aligning to the query:
6yv8A Mannosyltransferase pcmangt from pyrobaculum calidifontis in complex with gdp and mn2+ (see paper)
32% identity, 27% coverage: 24:128/388 of query aligns to 43:147/346 of 6yv8A
Sites not aligning to the query:
6yv9A Mannosyltransferase pcmangt from pyrobaculum calidifontis in complex with gdp-man and mn2+ (see paper)
32% identity, 27% coverage: 24:128/388 of query aligns to 42:146/345 of 6yv9A
Sites not aligning to the query:
>Synpcc7942_0150 FitnessBrowser__SynE:Synpcc7942_0150
LSRGAIASYAGQQFASEPQWLALPFLSLVIPTFNEAENIQPLLLQLNELLDRALADRYEL
IVVDDDSPDRTWALAEQLQPKLPMLTVLRRQGDRGLATAVVYGWQRAQGEILGVIDGDLQ
HPPETLLALIQTMQAGADLAVASRNVSGGGVSDWSVWRRLGSRGAQLLGLLILPEVLGRV
SDPMSGYFMVRRSRLDLPSLQPRGYKILLEVIAKGQIRQIREVGFIFRERSQGESKVTAR
EYWHYLQHLCSLRLQRWESARFLKFVGAGATGVIVDSVVLYLLHDPSRLGWPLLLSKFIA
AEVAILNNFVFNEFWTFGDLARGSQRRYWPRRFLKFNLICSLGIFLNLLILSLLVEGLKL
HYLPSNWVAIAVVTLWNFWLNRKLTWVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory