Comparing Synpcc7942_0158 FitnessBrowser__SynE:Synpcc7942_0158 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9VLJ8 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Ubiquitin activating enzyme 4; EC 2.7.7.80; EC 2.8.1.11 from Drosophila melanogaster (Fruit fly) (see paper)
42% identity, 98% coverage: 10:391/391 of query aligns to 63:453/453 of Q9VLJ8
Sites not aligning to the query:
O95396 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; EC 2.7.7.80; EC 2.8.1.11 from Homo sapiens (Human) (see 5 papers)
43% identity, 97% coverage: 11:391/391 of query aligns to 55:460/460 of O95396
Q72J02 Sulfur carrier protein adenylyltransferase; E1-like protein TtuC; Sulfur carrier protein MoaD adenylyltransferase; Sulfur carrier protein ThiS adenylyltransferase; Sulfur carrier protein TtuB adenylyltransferase; tRNA two-thiouridine-synthesizing protein C; EC 2.7.7.80; EC 2.7.7.73; EC 2.7.7.- from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
53% identity, 66% coverage: 9:267/391 of query aligns to 1:270/271 of Q72J02
P38820 Adenylyltransferase and sulfurtransferase UBA4; Needs CLA4 to survive protein 3; Ubiquitin-like protein activator 4; EC 2.7.7.-; EC 2.8.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
38% identity, 97% coverage: 11:391/391 of query aligns to 39:440/440 of P38820
D4GSF3 SAMP-activating enzyme E1; Ubiquitin-like activating enzyme of archaea; Ubl-activating enzyme; EC 2.7.7.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
49% identity, 68% coverage: 2:267/391 of query aligns to 1:267/270 of D4GSF3
O59954 Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; EC 2.7.7.80; EC 2.8.1.11 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
36% identity, 97% coverage: 11:391/391 of query aligns to 61:482/482 of O59954
6yubA Crystal structure of uba4 from chaetomium thermophilum (see paper)
34% identity, 97% coverage: 11:389/391 of query aligns to 6:421/423 of 6yubA
P12282 Molybdopterin-synthase adenylyltransferase; MoaD protein adenylase; Molybdopterin-converting factor subunit 1 adenylase; Sulfur carrier protein MoaD adenylyltransferase; EC 2.7.7.80 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 62% coverage: 10:250/391 of query aligns to 3:242/249 of P12282
Sites not aligning to the query:
1jwbB Structure of the covalent acyl-adenylate form of the moeb-moad protein complex (see paper)
39% identity, 62% coverage: 10:250/391 of query aligns to 2:234/240 of 1jwbB
Sites not aligning to the query:
1jw9B Structure of the native moeb-moad protein complex (see paper)
39% identity, 62% coverage: 10:250/391 of query aligns to 2:234/240 of 1jw9B
Sites not aligning to the query:
6yubB Crystal structure of uba4 from chaetomium thermophilum (see paper)
45% identity, 54% coverage: 11:223/391 of query aligns to 7:215/289 of 6yubB
Sites not aligning to the query:
1jwaB Structure of the atp-bound moeb-moad protein complex (see paper)
36% identity, 61% coverage: 10:246/391 of query aligns to 2:215/217 of 1jwaB
1zfnA Structural analysis of escherichia coli thif (see paper)
38% identity, 61% coverage: 15:254/391 of query aligns to 5:242/244 of 1zfnA
Sites not aligning to the query:
P30138 Sulfur carrier protein ThiS adenylyltransferase; EC 2.7.7.73 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 61% coverage: 15:254/391 of query aligns to 5:242/251 of P30138
Sites not aligning to the query:
1zud3 Structure of this-thif protein complex (see paper)
37% identity, 61% coverage: 15:254/391 of query aligns to 5:237/240 of 1zud3
Sites not aligning to the query:
O42939 Ubiquitin-activating enzyme E1-like; Pmt3-activating enzyme subunit 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 44% coverage: 26:196/391 of query aligns to 13:182/628 of O42939
Sites not aligning to the query:
Q19360 NEDD8-activating enzyme E1 catalytic subunit; Ectopic membrane ruffles in embryo protein 1; Ubiquitin-activating enzyme 3 homolog; EC 6.2.1.64 from Caenorhabditis elegans (see paper)
32% identity, 46% coverage: 8:185/391 of query aligns to 14:190/430 of Q19360
Sites not aligning to the query:
Q7SXG4 SUMO-activating enzyme subunit 2; Ubiquitin-like 1-activating enzyme E1B; Ubiquitin-like modifier-activating enzyme 2; EC 2.3.2.- from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
29% identity, 35% coverage: 36:170/391 of query aligns to 16:151/650 of Q7SXG4
Sites not aligning to the query:
3gznB Structure of nedd8-activating enzyme in complex with nedd8 and mln4924 (see paper)
30% identity, 47% coverage: 33:214/391 of query aligns to 32:192/429 of 3gznB
Sites not aligning to the query:
1tt5B Structure of appbp1-uba3-ubc12n26: a unique e1-e2 interaction required for optimal conjugation of the ubiquitin-like protein nedd8 (see paper)
30% identity, 47% coverage: 33:214/391 of query aligns to 35:195/414 of 1tt5B
Sites not aligning to the query:
>Synpcc7942_0158 FitnessBrowser__SynE:Synpcc7942_0158
MLNLDTDSIQLTQDDYARYSRHLILPEVGLEGQKRLKAAKVLCIGTGGLGSPLLLYLAAA
GIGRIGIVDFDIVDHSNLQRQVIHGTSWVGKPKIESAKNRIHEINPYCQVDLYETALSSE
NALSILEPYDVIVDGTDNFPTRYLVNDACVLLGKPNVYGSIFRFEGQATVFNYEDGPNYR
DLYPEPPPPGMVPSCAEGGVLGILPGIIGVIQATETVKIILGQGQTLSGRLLLYNALDMK
FRELKLRPNPERPVIDRLIDYQEFCGIPQAQAAEAAATDSIPEISVTELKAILDRQDPEV
LLIDVRNPHEAEIATIPGAILVPLPDIEAGAGVETVRELLNGKRELIVHCKMGGRSAKAL
GILKEAGITGTNVAGGINAWSQDVDPSVPQY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory