Comparing Synpcc7942_0246 FitnessBrowser__SynE:Synpcc7942_0246 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
48% identity, 88% coverage: 45:359/359 of query aligns to 8:324/324 of 4z9nB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
32% identity, 48% coverage: 49:219/359 of query aligns to 1:163/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 48% coverage: 49:219/359 of query aligns to 1:161/225 of 4zv2A
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
27% identity, 50% coverage: 44:221/359 of query aligns to 2:176/231 of 2v25A
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
30% identity, 55% coverage: 27:222/359 of query aligns to 27:214/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
30% identity, 55% coverage: 27:222/359 of query aligns to 27:214/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
30% identity, 55% coverage: 27:222/359 of query aligns to 28:215/288 of 6h2tA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
28% identity, 48% coverage: 45:217/359 of query aligns to 3:165/229 of 6svfA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
25% identity, 50% coverage: 45:223/359 of query aligns to 7:177/251 of 1xt8B
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
26% identity, 65% coverage: 43:275/359 of query aligns to 1:218/229 of 5t0wA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 49% coverage: 48:223/359 of query aligns to 7:174/247 of 2yjpA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
25% identity, 74% coverage: 43:306/359 of query aligns to 7:265/278 of 2ia4B
2vhaA Debp (see paper)
25% identity, 74% coverage: 43:306/359 of query aligns to 6:264/276 of 2vhaA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
25% identity, 57% coverage: 45:249/359 of query aligns to 6:201/243 of 5eyfB
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
24% identity, 69% coverage: 43:290/359 of query aligns to 4:246/503 of 8ovoA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
30% identity, 35% coverage: 52:177/359 of query aligns to 1:122/224 of 4ymxA
Sites not aligning to the query:
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
29% identity, 39% coverage: 35:175/359 of query aligns to 1:132/241 of 3vvfA
Sites not aligning to the query:
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
29% identity, 39% coverage: 35:175/359 of query aligns to 1:132/241 of 3vveA
Sites not aligning to the query:
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
29% identity, 39% coverage: 35:175/359 of query aligns to 1:132/241 of 3vvdA
Sites not aligning to the query:
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
28% identity, 36% coverage: 45:175/359 of query aligns to 6:128/237 of 3vv5A
Sites not aligning to the query:
>Synpcc7942_0246 FitnessBrowser__SynE:Synpcc7942_0246
MKAILLSGGPMPAIASRFLLVLLCFLPLAACRSLGGNETESNSRLNQVQARGKLLCGVEG
RLPGFSFLDSQGNYSGLDVDICKAIAAALFNDPKAIEYRSLDSVERFPALASGEVDLLSR
NTTWTLSRDAKGGNNLEFAPTTFYDGQGLMVRRNSGIQSLQDFQGKSICVETGTTSELNL
ADTMRELGVQYQEIKFPNSDANYAAYAQGRCEGVTSDRSQLAARRTTLSDADQHQLLDAV
ISKEPLSPATLNNDSPWFDVVKWVVNATIQAEEFGITQANIDQFKTSKNPEIRRFLGLEG
ELGQQLGLSNDFAYRAIKAVGNYGEIYERNVGQQSPLKLNRGLNQLYKNGGLLYSPPFR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory