Comparing Synpcc7942_0256 FitnessBrowser__SynE:Synpcc7942_0256 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
40% identity, 91% coverage: 30:399/408 of query aligns to 7:368/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 92% coverage: 33:406/408 of query aligns to 48:422/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 89% coverage: 37:398/408 of query aligns to 56:418/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
37% identity, 94% coverage: 14:397/408 of query aligns to 1:378/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
37% identity, 73% coverage: 27:325/408 of query aligns to 16:314/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
25% identity, 83% coverage: 34:372/408 of query aligns to 19:338/391 of 3ramA
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
22% identity, 82% coverage: 38:371/408 of query aligns to 10:345/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
22% identity, 82% coverage: 38:371/408 of query aligns to 10:345/376 of 4o23A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
25% identity, 63% coverage: 55:311/408 of query aligns to 27:288/377 of 7t1qA
Sites not aligning to the query:
>Synpcc7942_0256 FitnessBrowser__SynE:Synpcc7942_0256
VGQSPCLLTIMLLLSQELPETVRPAVRDRHAQIVAWRQQLHRRPELGFQEQETAAFIAAR
LTELGVSFQAGVAGTGIVAEIAGQRSGPTLAIRADMDALPILEANEIPYRSEIDGRMHAC
GHDGHVAIALGTAACLQANSDFAGRVKIIFQPAEEGPGGAAPMIAEGVLENPAVDAIIGL
HLWNYLPLGKVGVRSGPLMAAVELFDLTIQGRGGHAAIPQNCIDAVLVASQIVTLLQSIV
SRNVDPLHSAVVTIGSLHAGTTYNVIADRAQLKGTVRYFDDRYQGFLQERIEQIVAGVCN
SHGATYELNYRKLYPAVINDSAIADLVRSVAEEVLEPPLGVVPDCQTMGAEDMSYFLQKV
PGCYFFLGSANLDRGLNFPHHHPRFNFDETALALGVELFLRCVERFCR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory