Comparing Synpcc7942_0262 Synpcc7942_0262 diaminopimelate decarboxylase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
39% identity, 91% coverage: 30:453/464 of query aligns to 10:442/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
39% identity, 91% coverage: 30:453/464 of query aligns to 9:441/446 of 1hkvA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
39% identity, 91% coverage: 30:453/464 of query aligns to 11:439/443 of 5x7mA
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
39% identity, 91% coverage: 30:453/464 of query aligns to 11:439/442 of 5x7nA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
34% identity, 90% coverage: 41:459/464 of query aligns to 15:434/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
34% identity, 90% coverage: 41:459/464 of query aligns to 11:430/434 of 1twiA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
34% identity, 90% coverage: 41:459/464 of query aligns to 11:430/434 of 1tufA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
33% identity, 91% coverage: 41:460/464 of query aligns to 8:418/418 of 4xg1B
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
32% identity, 87% coverage: 53:454/464 of query aligns to 6:396/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
33% identity, 87% coverage: 53:454/464 of query aligns to 4:388/394 of 3c5qA
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
33% identity, 86% coverage: 56:454/464 of query aligns to 8:381/385 of 2yxxA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
33% identity, 86% coverage: 56:454/464 of query aligns to 9:382/386 of Q9X1K5
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
31% identity, 90% coverage: 39:454/464 of query aligns to 8:417/422 of 6n2aA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
31% identity, 90% coverage: 43:460/464 of query aligns to 8:393/393 of 4xg1A
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
29% identity, 87% coverage: 51:453/464 of query aligns to 8:407/412 of 7ru7A
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
27% identity, 91% coverage: 29:449/464 of query aligns to 2:410/419 of 1ko0A
1knwA Crystal structure of diaminopimelate decarboxylase
27% identity, 91% coverage: 29:449/464 of query aligns to 2:410/421 of 1knwA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
27% identity, 91% coverage: 29:449/464 of query aligns to 3:411/420 of P00861
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
24% identity, 90% coverage: 41:456/464 of query aligns to 27:455/461 of 8d5rA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
24% identity, 90% coverage: 41:456/464 of query aligns to 27:457/461 of 8d88A
>Synpcc7942_0262 Synpcc7942_0262 diaminopimelate decarboxylase
MVSTPAAPSLNPQYPALFGTDRPSNSPNQNLFPLTASVTADGQLEVGGCRVSDLVERYGS
PLYILDEQTLRAACQSYRSALAHHYPGAALPIYASKAWNCLAVCALVAQEGLGIDVVSAG
ELYTALQAGVPSDRLYFHGNNKSLSELAMGVEAGCTIVVDNWQELRNLEAIAAEQQREVR
VMIRFTPGIECHTHEYIRTGHLDSKFGFDPDQLDALLAALVDQPYLRCIGLHAHIGSQIF
ELQPHADLAGVLVGAYAKALALGLPIAELNVGGGLGIRYTESDDPPSIDEWVRQVSESLV
AACQAADLPLPKLICEPGRSLIGTACVTAYQIGSRKEVPGIRTYLAVDGGMSDNPRPITY
QSTYRAVIANRLNVSDRETVTVAGKHCESGDVLLKDAELAPSQPGDILVVLATGAYNYSM
ASNYNRIARPAAVLVNNGEAQIILARESLQDLLRQDRLPVGLQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory