SitesBLAST
Comparing Synpcc7942_0276 FitnessBrowser__SynE:Synpcc7942_0276 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 92% coverage: 19:467/490 of query aligns to 13:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ A79), G75 (= G81), S76 (≠ A82), G77 (= G83), T78 (= T84), G79 (= G85), L80 (= L86), A83 (≠ G89), C84 (≠ A90), P137 (= P143), G138 (≠ S144), E139 (≠ S145), A142 (≠ C149), T143 (≠ S150), G146 (= G153), N147 (= N154), S149 (≠ A156), T150 (≠ E157), A152 (≠ S159), G153 (= G160), E203 (= E209), G204 (= G210), I209 (≠ A215), E422 (= E426), H423 (= H427)
- binding fe (iii) ion: H377 (= H382), H384 (= H389), E422 (= E426)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 87% coverage: 44:468/490 of query aligns to 33:456/459 of P9WIT1
- K354 (≠ F361) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ Q28), P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), W323 (≠ F337), E414 (= E426), H415 (= H427), N451 (= N463)
- binding manganese (ii) ion: H370 (= H382), H377 (= H389), E414 (= E426)
- binding pyruvic acid: R319 (= R333), H370 (= H382), H377 (= H389), H415 (= H427)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L86), R317 (= R333), W321 (≠ F337), H368 (= H382), H375 (= H389), H413 (= H427)
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), W321 (≠ F337), Y322 (≠ A338), E412 (= E426), H413 (= H427), N449 (= N463)
- binding manganese (ii) ion: H368 (= H382), H375 (= H389), E412 (= E426)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H427)
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), W322 (≠ F337), E413 (= E426), H414 (= H427), N450 (= N463)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E426)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), H369 (= H382), E413 (= E426), N450 (= N463)
- binding deaminohydroxyvaline: R319 (= R333), H414 (= H427)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R333), W322 (≠ F337), H369 (= H382), H376 (= H389), H414 (= H427)
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), W322 (≠ F337), E413 (= E426), N450 (= N463)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E426)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), Y324 (≠ A338), H370 (= H382), E414 (= E426), N451 (= N463)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R333), W323 (≠ F337), H415 (= H427)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R333), W323 (≠ F337), H370 (= H382), H415 (= H427)
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), H370 (= H382), E414 (= E426), N451 (= N463)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R333), W323 (≠ F337), H415 (= H427)
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), Y324 (≠ A338), H370 (= H382), E414 (= E426), N451 (= N463)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), H370 (= H382), E414 (= E426), N451 (= N463)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R333), W323 (≠ F337), H415 (= H427)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), H370 (= H382), E414 (= E426), N451 (= N463)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R333), H415 (= H427)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), Y324 (≠ A338), H370 (= H382), E414 (= E426), N451 (= N463)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L86), R319 (= R333), W323 (≠ F337), H415 (= H427)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 95% coverage: 3:468/490 of query aligns to 7:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), W322 (≠ F337), E413 (= E426), H414 (= H427), N450 (= N463)
- binding lactic acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H427)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E426)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ Q28), P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), W322 (≠ F337), E413 (= E426), H414 (= H427), N450 (= N463)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H427)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E426)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R333), W322 (≠ F337), H369 (= H382), H376 (= H389), H413 (= H427)
- binding flavin-adenine dinucleotide: E32 (≠ Q28), P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), W322 (≠ F337), E412 (= E426), H413 (= H427), N449 (= N463)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E426)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
31% identity, 95% coverage: 3:468/490 of query aligns to 7:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R333), W322 (≠ F337), S336 (≠ V349), H369 (= H382), H376 (= H389), H413 (= H427)
- binding flavin-adenine dinucleotide: P68 (≠ A79), G70 (= G81), T71 (≠ A82), G72 (= G83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (≠ T101), P132 (= P143), G133 (≠ S144), A134 (≠ S145), G140 (= G153), M141 (≠ N154), A143 (= A156), T144 (≠ E157), A146 (≠ S159), S147 (≠ G160), E200 (= E209), G201 (= G210), I206 (≠ A215), E412 (= E426), N449 (= N463)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E426)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
29% identity, 90% coverage: 29:470/490 of query aligns to 78:519/521 of Q8N465
- S109 (≠ T60) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V78) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A82) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L98) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M104) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V123) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A140) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A156) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P182) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (≠ A184) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D322) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R333) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F337) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ Y347) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ V349) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ E367) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G374) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H382) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G384) to V: slight reduction in catalytic activity
- N439 (= N387) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H389) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L391) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I392) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ Y394) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E426) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H427) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G428) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
29% identity, 90% coverage: 29:470/490 of query aligns to 26:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ G43), P76 (≠ A79), G78 (= G81), G79 (≠ A82), N80 (≠ G83), T81 (= T84), G82 (= G85), M83 (≠ L86), G86 (= G89), S87 (≠ A90), L140 (≠ P143), A142 (≠ S145), C146 (= C149), H147 (≠ S150), G150 (= G153), N151 (= N154), A153 (= A156), T154 (≠ E157), G208 (= G210), I212 (= I214), I213 (≠ A215), E423 (= E426), N460 (= N463)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
29% identity, 90% coverage: 29:470/490 of query aligns to 25:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R333), T337 (≠ F337), K348 (≠ V349), Y379 (≠ V380), H381 (= H382), H388 (= H389), H423 (= H427)
- binding flavin-adenine dinucleotide: W39 (≠ G43), P75 (≠ A79), Q76 (≠ R80), G77 (= G81), G78 (≠ A82), N79 (≠ G83), T80 (= T84), G81 (= G85), M82 (≠ L86), G85 (= G89), S86 (≠ A90), L139 (≠ P143), G140 (≠ S144), A141 (≠ S145), C145 (= C149), G149 (= G153), N150 (= N154), A152 (= A156), T153 (≠ E157), G157 (= G161), G207 (= G210), I212 (≠ A215), E422 (= E426), N459 (= N463)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E426)
Query Sequence
>Synpcc7942_0276 FitnessBrowser__SynE:Synpcc7942_0276
VSQPMTAVAAPNWTAIAQAFREVLGREQVVERREELLVYECDGLTNHRQIPPLVVLPRST
EEVAAAVRLCNQFDLSFVARGAGTGLSGGALPVEDSVLIVTARMRQILEIDYDNLRVRVQ
PGVINSWVTQATTGAGFFYAPDPSSQSVCSIGGNVAENSGGVHCLKHGVTNNHVLGLTLV
LPDASVIQVGGAIADLPGYDLCGIFVGSEGTLGIATEVTLRLQPLPQSVQVLLADFSSIE
AAGAAVSGIIAAGILPAGLELMDNFSINAVEDVVKSDCYPRDAAAILLAELDGRASEVAQ
QIRDVEAVCRQHGARSIAIATDAEDRLRLWKGRKAAFAAVGRISPSYYVQDGVIPRSTLP
FVLHEIEQLGQKHGYRVANVFHAGDGNLHPLILYDRNDPGALERVEALGGEILKLCVNVG
GSISGEHGIGADKRCYMPAMFSSEDLETMQWLRHAFDPLERANPTKVFPTPRTCGERGSV
NSIPVGVELY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory