SitesBLAST
Comparing Synpcc7942_0279 FitnessBrowser__SynE:Synpcc7942_0279 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
51% identity, 94% coverage: 25:524/534 of query aligns to 11:528/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C11 (= C25), C16 (= C30), C48 (= C62), F49 (≠ L63), L51 (= L65), C52 (= C66)
- binding flavin mononucleotide: G166 (= G167), G168 (= G169), N196 (= N195), D198 (= D197), F284 (= F283), G287 (= G286), E288 (= E287), E289 (= E288), N324 (= N323)
- binding iron/sulfur cluster: C457 (= C453), G458 (= G454), K459 (= K455), C460 (= C456), C463 (= C459), C503 (= C499), G506 (= G502)
- binding zinc ion: C440 (≠ D436), H527 (≠ R523)
Sites not aligning to the query:
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 533
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
47% identity, 94% coverage: 22:524/534 of query aligns to 28:559/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C31 (= C25), G33 (≠ A27), C36 (= C30), C82 (= C62), F85 (≠ L65), C86 (= C66)
- binding flavin mononucleotide: G201 (= G169), N227 (= N195), E230 (= E198), N355 (= N323), G535 (= G500), L536 (= L501)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E288), R337 (= R305), R340 (≠ Y308), T341 (≠ P309), N342 (≠ A310), S433 (= S398)
- binding iron/sulfur cluster: S487 (= S452), C488 (= C453), G489 (= G454), C491 (= C456), C494 (= C459), C534 (= C499), L536 (= L501), G537 (= G502)
- binding zinc ion: C471 (≠ D436), H558 (≠ R523)
Sites not aligning to the query:
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 564
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
50% identity, 92% coverage: 32:524/534 of query aligns to 13:513/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C41 (= C62), C45 (= C66)
- binding flavin mononucleotide: R154 (= R168), K164 (= K178), N181 (= N195), F269 (= F283), E273 (= E287), E274 (= E288), I307 (= I321), N308 (= N322), N309 (= N323), G489 (= G500), L490 (= L501)
- binding nicotinamide-adenine-dinucleotide: G155 (= G169), G156 (= G170), F159 (≠ Y173), F163 (≠ L177), E273 (= E287), E274 (= E288), K291 (≠ R305), F294 (≠ Y308), G413 (= G424)
- binding iron/sulfur cluster: P288 (= P302), C442 (= C453), G443 (= G454), C445 (= C456), C448 (= C459), C488 (= C499), L490 (= L501), G491 (= G502)
- binding zinc ion: C425 (≠ D436), H512 (≠ R523)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 518, 523
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
58% identity, 78% coverage: 114:528/534 of query aligns to 1:418/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D436), C364 (≠ S474), H413 (≠ R523)
- binding flavin mononucleotide: G54 (= G167), G56 (= G169), K65 (= K178), N82 (= N195), D84 (= D197), E85 (= E198), G173 (= G286), E175 (= E288), N210 (= N323), G390 (= G500), L391 (= L501)
- binding nicotinamide-adenine-dinucleotide: G56 (= G169), G57 (= G170), A58 (≠ G171), F60 (≠ Y173), K65 (= K178), F68 (≠ T181), E85 (= E198), E175 (= E288), R192 (= R305), F195 (≠ Y308), I312 (≠ M422), M313 (= M423), S315 (= S425)
- binding iron/sulfur cluster: S342 (= S452), C343 (= C453), G344 (= G454), C346 (= C456), C349 (= C459), S387 (= S497), C389 (= C499), L391 (= L501), G392 (= G502)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
58% identity, 78% coverage: 114:528/534 of query aligns to 1:418/425 of 7t2rB
Sites not aligning to the query:
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
48% identity, 94% coverage: 20:520/534 of query aligns to 26:541/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (= C25), G33 (≠ A27), T34 (= T28), C36 (= C30), C67 (= C62), C68 (≠ L63), G69 (= G64), R70 (≠ L65), C71 (= C66)
- binding flavin mononucleotide: G185 (= G167), R186 (= R168), G187 (= G169), N213 (= N195), D215 (= D197), E216 (= E198), G217 (= G199), F301 (= F283), G304 (= G286), E305 (= E287), E306 (= E288), N340 (= N322), N341 (= N323), G521 (= G500), L522 (= L501)
- binding iron/sulfur cluster: P320 (= P302), S473 (= S452), C474 (= C453), G475 (= G454), K476 (= K455), C477 (= C456), C480 (= C459), L519 (= L498), C520 (= C499), L522 (= L501), G523 (= G502)
- binding zinc ion: C457 (≠ D436)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
58% identity, 74% coverage: 131:524/534 of query aligns to 1:399/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G167), G39 (= G169), N67 (= N195), G158 (= G286), E159 (= E287), E160 (= E288), G375 (= G500)
- binding nicotinamide-adenine-dinucleotide: G40 (= G170), F43 (≠ Y173), K48 (= K178), R177 (= R305), F180 (≠ Y308), M297 (= M422)
- binding iron/sulfur cluster: S327 (= S452), C328 (= C453), G329 (= G454), K330 (= K455), C331 (= C456), C334 (= C459), L373 (= L498), C374 (= C499)
- binding zinc ion: C311 (≠ D436), H398 (≠ R523)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
60% identity, 69% coverage: 154:524/534 of query aligns to 1:376/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G167), G16 (= G169), N44 (= N195), G135 (= G286), E137 (= E288), N171 (= N322), N172 (= N323), G352 (= G500)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G169), G17 (= G170), F20 (≠ Y173), K25 (= K178), F28 (≠ T181), D49 (= D200), R154 (= R305), F157 (≠ Y308), S250 (= S398)
- binding iron/sulfur cluster: P151 (= P302), C305 (= C453), G306 (= G454), K307 (= K455), C308 (= C456), C311 (= C459), C351 (= C499), G354 (= G502)
- binding zinc ion: C288 (≠ D436), H375 (≠ R523)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 381, 386
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
45% identity, 76% coverage: 123:530/534 of query aligns to 19:435/437 of 4hea1
- binding flavin mononucleotide: G63 (= G167), K74 (= K178), N91 (= N195), D93 (= D197), Y179 (≠ F283), G182 (= G286), E183 (= E287), N218 (= N322), N219 (= N323), L401 (= L501)
- binding iron/sulfur cluster: I180 (≠ V284), P198 (= P302), S351 (= S452), C352 (= C453), G353 (= G454), K354 (= K455), C355 (= C456), C358 (= C459), F398 (≠ L498), C399 (= C499), L401 (= L501)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
45% identity, 76% coverage: 123:530/534 of query aligns to 19:435/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G167), G65 (= G169), N91 (= N195), D93 (= D197), G182 (= G286), E183 (= E287), E184 (= E288), N218 (= N322), N219 (= N323), T222 (= T326), P400 (≠ G500)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G169), G66 (= G170), F69 (≠ Y173), K74 (= K178), F77 (≠ T181), E96 (≠ D200), Y179 (≠ F283), E184 (= E288), K201 (≠ R305), F204 (≠ Y308), T324 (≠ S425)
- binding iron/sulfur cluster: S351 (= S452), C352 (= C453), K354 (= K455), C355 (= C456), C358 (= C459), F398 (≠ L498), C399 (= C499), L401 (= L501), A402 (≠ G502)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
44% identity, 81% coverage: 101:530/534 of query aligns to 1:436/438 of Q56222
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
41% identity, 86% coverage: 61:520/534 of query aligns to 40:492/493 of 6tg9B
- binding flavin mononucleotide: G146 (= G167), R147 (= R168), G148 (= G169), N174 (= N195), D176 (= D197), E177 (= E198), Y254 (≠ F283), G257 (= G286), E258 (= E287), N293 (= N322), N294 (= N323), S297 (≠ T326)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F152 (≠ Y173), K157 (= K178), E258 (= E287), E259 (= E288), L279 (≠ Y308), K466 (= K494), L470 (= L498)
- binding iron/sulfur cluster: S426 (= S452), C427 (= C453), G428 (= G454), T429 (≠ K455), C430 (= C456), C433 (= C459), L470 (= L498), C471 (= C499), G474 (= G502)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
44% identity, 78% coverage: 106:520/534 of query aligns to 94:510/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G167), G156 (= G169), K165 (= K178), N182 (= N195), E185 (= E198), G273 (= G286), E274 (= E287), E275 (= E288), N309 (= N322), N310 (= N323), S313 (≠ T326), A490 (≠ G500), M491 (≠ L501)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (≠ G171), F160 (≠ Y173), K165 (= K178), T168 (= T181), E275 (= E288), L295 (≠ Y308)
- binding iron/sulfur cluster: V271 (= V284), V289 (≠ P302), S442 (= S452), C443 (= C453), G444 (= G454), K445 (= K455), C446 (= C456), C449 (= C459), L488 (= L498), C489 (= C499), M491 (≠ L501), G492 (= G502)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
41% identity, 73% coverage: 132:522/534 of query aligns to 30:415/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G167), G66 (= G169), K75 (= K178), N91 (= N195), D93 (= D197), E94 (= E198), G182 (= G286), E183 (= E287), E184 (= E288), V217 (≠ I321), N218 (= N322), N219 (= N323), T222 (= T326), G393 (= G500)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G169), G67 (= G170), A68 (≠ G171), F70 (≠ Y173), K75 (= K178), E94 (= E198), E96 (≠ D200), Y179 (≠ F283), E184 (= E288), Y204 (= Y308)
- binding iron/sulfur cluster: P198 (= P302), T345 (≠ S452), C346 (= C453), G347 (= G454), Q348 (≠ K455), C349 (= C456), C352 (= C459), I391 (≠ L498), C392 (= C499), L394 (= L501), G395 (= G502)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
41% identity, 73% coverage: 132:522/534 of query aligns to 30:415/419 of 6saqB
- binding flavin mononucleotide: G64 (= G167), G66 (= G169), K75 (= K178), N91 (= N195), D93 (= D197), E94 (= E198), Y179 (≠ F283), G182 (= G286), E183 (= E287), N218 (= N322), N219 (= N323), T222 (= T326)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G169), G67 (= G170), A68 (≠ G171), F70 (≠ Y173), K75 (= K178), E94 (= E198), E96 (≠ D200), T99 (≠ A203), E184 (= E288), Y204 (= Y308), T318 (≠ S425)
- binding iron/sulfur cluster: P198 (= P302), T345 (≠ S452), C346 (= C453), G347 (= G454), Q348 (≠ K455), C349 (= C456), C352 (= C459), I391 (≠ L498), C392 (= C499), G395 (= G502)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
41% identity, 73% coverage: 132:522/534 of query aligns to 29:414/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G167), G65 (= G169), K74 (= K178), N90 (= N195), D92 (= D197), E93 (= E198), G181 (= G286), E182 (= E287), E183 (= E288), V216 (≠ I321), N217 (= N322), N218 (= N323), T221 (= T326)
- binding nicotinamide-adenine-dinucleotide: G65 (= G169), G66 (= G170), A67 (≠ G171), F69 (≠ Y173), K74 (= K178), E95 (≠ D200), Y178 (≠ F283), E183 (= E288), K200 (≠ R305), Y203 (= Y308)
- binding iron/sulfur cluster: I179 (≠ V284), P197 (= P302), T344 (≠ S452), C345 (= C453), G346 (= G454), Q347 (≠ K455), C348 (= C456), C351 (= C459), S389 (= S497), I390 (≠ L498), C391 (= C499), L393 (= L501), G394 (= G502)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
41% identity, 73% coverage: 132:522/534 of query aligns to 31:416/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G167), G67 (= G169), K76 (= K178), N92 (= N195), E95 (= E198), Y180 (≠ F283), G183 (= G286), E184 (= E287), V218 (≠ I321), N219 (= N322), N220 (= N323), T223 (= T326)
- binding iron/sulfur cluster: T346 (≠ S452), C347 (= C453), G348 (= G454), Q349 (≠ K455), C350 (= C456), C353 (= C459), S391 (= S497), I392 (≠ L498), C393 (= C499), G396 (= G502)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
39% identity, 74% coverage: 129:522/534 of query aligns to 23:421/442 of 7p61F
- binding flavin mononucleotide: G61 (= G167), G63 (= G169), K72 (= K178), N90 (= N195), D92 (= D197), G181 (= G286), E182 (= E287), N217 (= N322), N218 (= N323), A399 (≠ G500), H400 (≠ L501)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G169), G64 (= G170), A65 (≠ G171), F67 (≠ Y173), K72 (= K178), L75 (≠ T181), E95 (≠ D200), Y178 (≠ F283), E183 (= E288), F203 (≠ Y308), R320 (≠ M422), T323 (≠ S425)
- binding iron/sulfur cluster: S350 (= S452), C351 (= C453), W353 (≠ K455), C354 (= C456), C357 (= C459), F397 (≠ L498), C398 (= C499), H400 (≠ L501)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
38% identity, 76% coverage: 119:524/534 of query aligns to 6:421/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G167), R54 (= R168), G55 (= G169), A57 (≠ G171), K64 (= K178), N90 (= N195), D92 (= D197), Y178 (≠ F283), G181 (= G286), E182 (= E287), E183 (= E288), N217 (= N322), N218 (= N323), S221 (≠ T326), L398 (= L501)
- binding iron/sulfur cluster: P197 (= P302), S349 (= S452), C350 (= C453), G351 (= G454), K352 (= K455), C353 (= C456), C356 (= C459), S394 (= S497), F395 (≠ L498), C396 (= C499), L398 (= L501), G399 (= G502)
- binding zinc ion: C333 (≠ D436), E371 (≠ S474), H420 (≠ R523)
Sites not aligning to the query:
6zk91 Peripheral domain of open complex i during turnover (see paper)
39% identity, 70% coverage: 153:524/534 of query aligns to 45:422/430 of 6zk91
- binding flavin mononucleotide: G59 (= G167), G61 (= G169), K70 (= K178), N88 (= N195), D90 (= D197), E91 (= E198), G179 (= G286), E180 (= E287), A215 (≠ N322), N216 (= N323), A398 (≠ G500), L399 (= L501)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G169), G62 (= G170), A63 (≠ G171), F65 (≠ Y173), K70 (= K178), E93 (≠ D200), Y176 (≠ F283), E181 (= E288), F201 (≠ Y308), T323 (≠ S425)
- binding iron/sulfur cluster: I177 (≠ V284), P195 (= P302), C351 (= C453), G352 (= G454), Q353 (≠ K455), C354 (= C456), C357 (= C459), T395 (≠ S497), C397 (= C499), L399 (= L501)
Query Sequence
>Synpcc7942_0279 FitnessBrowser__SynE:Synpcc7942_0279
MDWEDLGRLANEELTCQKPIRLRCCTATGCRANGAEAVFKAVQQTIADQNLGDRCEAVSV
GCLGLCGAGPLVQCDPSDRLYSDIRPDQAADLVAAAQGAAMDLPEVDQAQPFFSQQLKIV
NRHSGLINPDRLESYLAAGGYRALMHTIFDLTPTEVVEIIRLSGLRGRGGGGYPTGLKWA
TVAKMPSDRKFVVCNGDEGDPGAFMDRSVLESDPHQVIEGMAIAAYAVGANFGYLYVRAE
YPLAIARLNQAIRQARRRGLLGNSVLDSRFSFDLEVRIGAGAFVCGEETALIHSIQGERG
VPRVRPPYPAESGLWGHPTLINNVETFANIAPIVEQGADWFAAIGTPTSKGTKVFALTGK
LRNNGLIEVPMGIPLRSIVDGMGIPESPVKAVQTGGPSGGCIPLAQLDTPVDYDSLIQLG
SMMGSGGMVVMDENTDMVAIARFYMEFCRSESCGKCIPCRAGTVQLHELLGKLSSGQGTA
IDLQQLEDLCYLVKDTSLCGLGMSAPNPILSTLRWFRQEYESRLIPERAIALTH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory