SitesBLAST
Comparing Synpcc7942_0320 FitnessBrowser__SynE:Synpcc7942_0320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2c20A Crystal structure of udp-glucose 4-epimerase
49% identity, 97% coverage: 5:327/332 of query aligns to 2:322/329 of 2c20A
- active site: T117 (= T122), A118 (≠ C123), A119 (= A124), Y141 (= Y146), K145 (= K150), H184 (= H189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), Q34 (≠ S37), T35 (≠ N38), G36 (= G39), D51 (= D56), L52 (≠ T57), F73 (= F78), A74 (= A79), A75 (= A80), N92 (= N97), Y141 (= Y146), K145 (= K150), Y168 (= Y173), F169 (= F174), V171 (≠ A176), H184 (= H189)
- binding zinc ion: E182 (= E187), H184 (= H189), E187 (= E192), H189 (= H194)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
50% identity, 95% coverage: 5:321/332 of query aligns to 3:316/325 of 4twrA
- active site: S117 (≠ T122), C118 (= C123), A119 (= A124), Y141 (= Y146), K145 (= K150), H184 (= H189), H189 (= H194)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (≠ Y14), I13 (= I15), D32 (= D34), N33 (= N35), L34 (= L36), S35 (= S37), T36 (≠ N38), G37 (= G39), D51 (= D56), I52 (≠ T57), F73 (= F78), A74 (= A79), A75 (= A80), N92 (= N97), S115 (= S120), K145 (= K150), Y168 (= Y173), A171 (= A176), H184 (= H189)
- binding zinc ion: E182 (= E187), H184 (= H189), E187 (= E192), H189 (= H194)
2cnbA Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with NAD and the substrate analogue udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
43% identity, 97% coverage: 6:326/332 of query aligns to 5:359/366 of 2cnbA
- active site: S144 (≠ T122), A145 (≠ C123), A146 (= A124), Y169 (= Y146), K173 (= K150)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D34 (= D34), S35 (≠ N35), V37 (vs. gap), G38 (vs. gap), D77 (= D56), V78 (≠ T57), M100 (≠ F78), C101 (≠ A79), A102 (= A80), L104 (≠ I82), N119 (= N97), S143 (= S121), S144 (≠ T122), Y169 (= Y146), K173 (= K150), Y196 (= Y173), F197 (= F174), A199 (= A176)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: L104 (≠ I82), S144 (≠ T122), Y169 (= Y146), F197 (= F174), N198 (= N175), H217 (= H194), L218 (= L195), P238 (≠ Q211), I239 (≠ V212), F240 (≠ Y213), C251 (= C224), R253 (= R226), V297 (= V264), R320 (= R287), D323 (= D290)
1gy8C Trypanosoma brucei udp-galactose 4' epimerase (see paper)
42% identity, 97% coverage: 6:326/332 of query aligns to 5:363/370 of 1gy8C
- active site: S144 (≠ T122), A145 (≠ C123), A146 (= A124), Y170 (= Y146), K174 (= K150)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D34 (= D34), S35 (≠ N35), L36 (= L36), V37 (vs. gap), G38 (vs. gap), D77 (= D56), V78 (≠ T57), M100 (≠ F78), C101 (≠ A79), A102 (= A80), L104 (≠ I82), N119 (= N97), S142 (= S120), S143 (= S121), S144 (≠ T122), Y170 (= Y146), K174 (= K150), Y197 (= Y173), A200 (= A176)
- binding uridine-5'-diphosphate: N199 (= N175), H218 (= H194), L219 (= L195), I222 (≠ L198), M241 (≠ I210), P242 (≠ Q211), I243 (≠ V212), F244 (≠ Y213), C255 (= C224), R257 (= R226), R324 (= R287), D327 (= D290)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
42% identity, 98% coverage: 3:328/332 of query aligns to 1:329/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), S35 (= S37), G37 (= G39), D57 (= D56), L58 (≠ T57), F79 (= F78), A80 (= A79), I83 (= I82), N98 (= N97), Y147 (= Y146), K151 (= K150), Y175 (= Y173), N177 (= N175), V178 (≠ A176)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
43% identity, 97% coverage: 5:327/332 of query aligns to 3:337/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), N36 (= N38), D62 (= D56), L63 (≠ T57), F84 (= F78), A85 (= A79), G86 (≠ A80), K88 (≠ I82), N103 (= N97), S126 (= S120), S128 (≠ T122), Y152 (= Y146), K156 (= K150), Y180 (= Y173), P183 (≠ A176)
- binding uridine-5'-diphosphate-glucose: S128 (≠ T122), A129 (≠ C123), F181 (= F174), N182 (= N175), N202 (≠ H194), L203 (= L195), T219 (≠ Q211), V220 (= V212), Y221 (= Y213), R234 (= R226), Y236 (= Y228), V275 (= V264), R298 (= R287), D301 (= D290)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
43% identity, 97% coverage: 5:327/332 of query aligns to 3:337/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), N36 (= N38), D62 (= D56), L63 (≠ T57), F84 (= F78), A85 (= A79), G86 (≠ A80), K88 (≠ I82), N103 (= N97), S126 (= S120), S128 (≠ T122), Y152 (= Y146), K156 (= K150), Y180 (= Y173), P183 (≠ A176)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N175), N202 (≠ H194), L203 (= L195), T219 (≠ Q211), Y221 (= Y213), R234 (= R226), Y236 (= Y228), V275 (= V264), R298 (= R287), D301 (= D290)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 97% coverage: 6:326/332 of query aligns to 73:403/419 of Q9SA77
- G275 (≠ P197) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R226) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
41% identity, 97% coverage: 6:327/332 of query aligns to 5:339/348 of Q14376
- GYI 12:14 (= GYI 13:15) binding
- DNFHN 33:37 (≠ DNLSN 34:38) binding
- N34 (= N35) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ DT 56:57) binding
- F88 (= F78) binding
- G90 (≠ A80) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ I82) binding
- V94 (= V84) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ N93) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (≠ T122) mutation to A: Loss of activity.
- SAT 132:134 (≠ TCA 122:124) binding
- Y157 (= Y146) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K150) binding
- A180 (≠ S168) to V: in dbSNP:rs3204468
- L183 (≠ F171) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y173) binding
- YFN 185:187 (= YFN 173:175) binding
- NNL 206:208 (≠ THL 193:195) binding
- NVF 224:226 (≠ QVY 211:213) binding
- R239 (= R226) binding
- K257 (≠ Y244) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RPGD 287:290) binding
- C307 (≠ L294) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ K300) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G306) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ Q323) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
42% identity, 97% coverage: 6:327/332 of query aligns to 3:331/338 of 2udpA
- active site: S124 (≠ T122), A125 (≠ C123), T126 (≠ A124), Y149 (= Y146), K153 (= K150), M189 (≠ L185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D56), I59 (≠ T57), F80 (= F78), A81 (= A79), G82 (≠ A80), K84 (≠ I82), S122 (= S120), S124 (≠ T122), Y149 (= Y146), K153 (= K150), Y177 (= Y173)
- binding phenyl-uridine-5'-diphosphate: N179 (= N175), N199 (≠ H194), L200 (= L195), A216 (≠ Q211), I217 (≠ V212), F218 (≠ Y213), R231 (= R226), Y233 (= Y228), V269 (= V264), R292 (= R287), D295 (= D290)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
42% identity, 97% coverage: 6:327/332 of query aligns to 3:331/338 of 1udcA
- active site: S124 (≠ T122), A125 (≠ C123), T126 (≠ A124), Y149 (= Y146), K153 (= K150), M189 (≠ L185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D56), I59 (≠ T57), F80 (= F78), A81 (= A79), G82 (≠ A80), K84 (≠ I82), S122 (= S120), Y149 (= Y146), K153 (= K150), Y177 (= Y173), P180 (≠ A176)
- binding uridine-5'-diphosphate-mannose: T126 (≠ A124), Y149 (= Y146), N179 (= N175), N199 (≠ H194), L200 (= L195), L215 (≠ I210), A216 (≠ Q211), I217 (≠ V212), F218 (≠ Y213), R231 (= R226), Y233 (= Y228), V269 (= V264), R292 (= R287)
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
42% identity, 97% coverage: 6:327/332 of query aligns to 3:331/338 of 1udaA
- active site: S124 (≠ T122), A125 (≠ C123), T126 (≠ A124), Y149 (= Y146), K153 (= K150), M189 (≠ L185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D56), I59 (≠ T57), F80 (= F78), A81 (= A79), G82 (≠ A80), K84 (≠ I82), S122 (= S120), Y149 (= Y146), K153 (= K150), Y177 (= Y173), P180 (≠ A176)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ A124), N179 (= N175), N199 (≠ H194), L200 (= L195), A216 (≠ Q211), I217 (≠ V212), F218 (≠ Y213), R231 (= R226), Y233 (= Y228), R292 (= R287), D295 (= D290), Y299 (≠ L294)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
42% identity, 97% coverage: 6:327/332 of query aligns to 3:331/338 of 1naiA
- active site: S124 (≠ T122), A125 (≠ C123), T126 (≠ A124), Y149 (= Y146), K153 (= K150), M189 (≠ L185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D56), I59 (≠ T57), F80 (= F78), A81 (= A79), G82 (≠ A80), K84 (≠ I82), Y149 (= Y146), K153 (= K150), Y177 (= Y173), P180 (≠ A176)
- binding 1,3-propandiol: N35 (= N38), K84 (≠ I82), E191 (= E187), P193 (= P191)
- binding uridine-5'-diphosphate: N179 (= N175), N199 (≠ H194), L200 (= L195), L215 (≠ I210), A216 (≠ Q211), R231 (= R226), Y233 (= Y228), R292 (= R287)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
42% identity, 97% coverage: 6:327/332 of query aligns to 3:331/338 of 1lrjA
- active site: S124 (≠ T122), A125 (≠ C123), T126 (≠ A124), Y149 (= Y146), K153 (= K150), M189 (≠ L185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D56), I59 (≠ T57), F80 (= F78), A81 (= A79), G82 (≠ A80), K84 (≠ I82), Y149 (= Y146), K153 (= K150), Y177 (= Y173), P180 (≠ A176)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V84), S124 (≠ T122), F178 (= F174), N179 (= N175), L200 (= L195), L215 (≠ I210), A216 (≠ Q211), F218 (≠ Y213), R231 (= R226), Y233 (= Y228), V269 (= V264), R292 (= R287), D295 (= D290)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
42% identity, 97% coverage: 6:327/332 of query aligns to 3:331/338 of P09147
- YI 11:12 (= YI 14:15) binding
- DNLCNS 31:36 (≠ DNLSNG 34:39) binding
- DI 58:59 (≠ DT 56:57) binding
- FAGLK 80:84 (≠ FAASI 78:82) binding
- N99 (= N97) binding
- S124 (≠ T122) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y146) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K150) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F174) binding
- Y299 (≠ L294) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
41% identity, 97% coverage: 6:327/332 of query aligns to 5:339/346 of 1ek6A
- active site: S132 (≠ T122), A133 (≠ C123), T134 (≠ A124), Y157 (= Y146), K161 (= K150)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D33 (= D34), N34 (= N35), H36 (≠ S37), N37 (= N38), D66 (= D56), I67 (≠ T57), F88 (= F78), A89 (= A79), G90 (≠ A80), K92 (≠ I82), S130 (= S120), S131 (= S121), S132 (≠ T122), Y157 (= Y146), K161 (= K150), Y185 (= Y173), P188 (≠ A176)
- binding uridine-5'-diphosphate-glucose: S132 (≠ T122), Y157 (= Y146), F186 (= F174), N187 (= N175), N207 (≠ H194), L208 (= L195), N224 (≠ Q211), V225 (= V212), F226 (≠ Y213), R239 (= R226), Y241 (= Y228), V277 (= V264), R300 (= R287), D303 (= D290)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
42% identity, 97% coverage: 6:327/332 of query aligns to 3:331/338 of 1kvrA
- active site: A124 (≠ T122), A125 (≠ C123), T126 (≠ A124), Y149 (= Y146), K153 (= K150), M189 (≠ L185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D56), I59 (≠ T57), F80 (= F78), A81 (= A79), G82 (≠ A80), K84 (≠ I82), S122 (= S120), S123 (= S121), Y149 (= Y146), K153 (= K150), Y177 (= Y173), P180 (≠ A176)
- binding uridine-5'-diphosphate: N179 (= N175), N198 (≠ T193), N199 (≠ H194), L200 (= L195), A216 (≠ Q211), I217 (≠ V212), F218 (≠ Y213), R231 (= R226), Y233 (= Y228), V269 (= V264), R292 (= R287), D295 (= D290)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
41% identity, 97% coverage: 6:327/332 of query aligns to 4:338/345 of 1hzjA
- active site: S131 (≠ T122), A132 (≠ C123), T133 (≠ A124), Y156 (= Y146), K160 (= K150)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ S37), N36 (= N38), D65 (= D56), I66 (≠ T57), F87 (= F78), A88 (= A79), G89 (≠ A80), K91 (≠ I82), S129 (= S120), S131 (≠ T122), Y156 (= Y146), K160 (= K150), Y184 (= Y173), P187 (≠ A176)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N175), N206 (≠ H194), L207 (= L195), N223 (≠ Q211), V224 (= V212), F225 (≠ Y213), R238 (= R226), Y240 (= Y228), V276 (= V264), R299 (= R287), D302 (= D290)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
40% identity, 97% coverage: 6:327/332 of query aligns to 4:338/347 of 1i3lA
- active site: S131 (≠ T122), A132 (≠ C123), T133 (≠ A124), Y156 (= Y146), K160 (= K150)
- binding galactose-uridine-5'-diphosphate: N186 (= N175), N206 (≠ H194), L207 (= L195), N223 (≠ Q211), V224 (= V212), F225 (≠ Y213), R238 (= R226), Y240 (= Y228), V276 (= V264), R299 (= R287), D302 (= D290)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ S37), N36 (= N38), D65 (= D56), I66 (≠ T57), F87 (= F78), A88 (= A79), G89 (≠ A80), K91 (≠ I82), S129 (= S120), S130 (= S121), S131 (≠ T122), Y156 (= Y146), K160 (= K150), Y184 (= Y173), P187 (≠ A176)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
40% identity, 97% coverage: 6:327/332 of query aligns to 4:338/347 of 1i3kA
- active site: S131 (≠ T122), A132 (≠ C123), T133 (≠ A124), Y156 (= Y146), K160 (= K150)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ S37), N36 (= N38), D65 (= D56), I66 (≠ T57), F87 (= F78), A88 (= A79), G89 (≠ A80), K91 (≠ I82), S129 (= S120), S131 (≠ T122), Y156 (= Y146), K160 (= K150), Y184 (= Y173), P187 (≠ A176)
- binding uridine-5'-diphosphate-glucose: F185 (= F174), N186 (= N175), N206 (≠ H194), L207 (= L195), N223 (≠ Q211), V224 (= V212), F225 (≠ Y213), R238 (= R226), Y240 (= Y228), V276 (= V264), R299 (= R287), D302 (= D290)
Query Sequence
>Synpcc7942_0320 FitnessBrowser__SynE:Synpcc7942_0320
VAGATILVTGGAGYIGSHTVRALQAQGYQPIVLDNLSNGQRAIAAEVLQVPLIVGDTRDR
LLLDRLFAEHPIQAVIHFAASIEVGESVRDPGNFYANNVSGSLTLLQAMVAAGCQQLVFS
STCATYGLPQVIPIPEDHPQAPINPYGRSKWMVEQFLQDFQAAYGLRSVIFRYFNAAGAD
PKGDLGEAHDPETHLIPLVLQAAAGQRPSIQVYGTDYPTSDGTCIRDYIHVCDLADAHVR
GLTYLADGGATTAFNLGNGNGFSVKEVIATAERVTQRSIPVQLSDRRPGDAIALVGSSDK
ARQILGWEPQFPSLETMIQHAWQWQQRCDRPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory