Comparing Synpcc7942_0397 FitnessBrowser__SynE:Synpcc7942_0397 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5gopA Crystal structure of alkaline invertase inva from anabaena sp. Pcc 7120 complexed with sucrose (see paper)
39% identity, 96% coverage: 16:459/463 of query aligns to 2:446/447 of 5gopA
5gooA Crystal structure of alkaline invertase inva from anabaena sp. Pcc 7120 complexed with fructose (see paper)
40% identity, 96% coverage: 16:458/463 of query aligns to 4:447/447 of 5gooA
5z74A Crystal structure of alkaline/neutral invertase invb from anabaena sp. Pcc 7120 complexed with sucrose (see paper)
38% identity, 94% coverage: 24:458/463 of query aligns to 12:441/441 of 5z74A
Q9LQF2 Alkaline/neutral invertase CINV1; AtCINV1; Alkaline/neutral invertase G; A/N-INVG; Cytosolic invertase 1; AtCYT-INV1; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 94% coverage: 25:459/463 of query aligns to 94:532/551 of Q9LQF2
Sites not aligning to the query:
Q69T31 Cytosolic invertase 1; OsCYT-INV1; EC 3.2.1.26 from Oryza sativa subsp. japonica (Rice) (see paper)
35% identity, 94% coverage: 25:459/463 of query aligns to 106:544/562 of Q69T31
Q9FK88 Alkaline/neutral invertase E, chloroplastic; A/N-INVE; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 96% coverage: 16:458/463 of query aligns to 129:583/617 of Q9FK88
>Synpcc7942_0397 FitnessBrowser__SynE:Synpcc7942_0397
MPDSVVLPATLQTALQTAEQLLWDRALVRYHDQWAGAIAALPEDQELAAANYREIFIRDN
VPVMLYLLLQGKTDVVRDFLQLSLSLQSQALQTYGILPTSFVCEETHCVADYGQRAIGRV
VSADPSLWWPVLLQAYRRASHDDAFVHSPTVQQGLQRLLAFLLRPVFNQNPLLEVPDGAF
MVDRPLDVAGAPLEIQVLLYGALRACGQLLQYTEAANAAHVQARRLRQYLCWHYWVTPDR
LRRWQQWPTEEFGDRSHNPYNIQPIAIPDWVEPWLGESGGYFLGNIRAGRPDFRFFSLGN
LLAIVFDVLPLNQQGAILRLILQNEAQILGQVPLRLCYPALTGSAWKILTGCDPKNQPWS
YHNGGSWPSLLWYLSAAVLHYQQRGGDRNLCQVWLNKLQHYHTQQCEQLPGDEWPEYYEG
QDSVQIATRACRYQTWTFTGLLLNHALLSQPQGIQLLSLRGLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory