Comparing Synpcc7942_0458 FitnessBrowser__SynE:Synpcc7942_0458 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3s8yA Bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
61% identity, 100% coverage: 1:277/278 of query aligns to 2:277/277 of 3s8yA
3i6yA Structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
61% identity, 100% coverage: 1:278/278 of query aligns to 2:278/278 of 3i6yA
P33018 S-formylglutathione hydrolase YeiG; FGH; EC 3.1.2.12 from Escherichia coli (strain K12) (see paper)
59% identity, 99% coverage: 1:276/278 of query aligns to 1:276/278 of P33018
P10768 S-formylglutathione hydrolase; FGH; Esterase D; Methylumbelliferyl-acetate deacetylase; EC 3.1.2.12; EC 3.1.1.56 from Homo sapiens (Human) (see 4 papers)
51% identity, 100% coverage: 1:278/278 of query aligns to 3:282/282 of P10768
3e4dA Structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens (see paper)
51% identity, 100% coverage: 1:277/278 of query aligns to 2:278/278 of 3e4dA
3fcxB Crystal structure of human esterase d (see paper)
51% identity, 100% coverage: 1:277/278 of query aligns to 1:275/275 of 3fcxB
Q8LAS8 S-formylglutathione hydrolase; AtSFGH; Esterase D; EC 3.1.2.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
51% identity, 98% coverage: 4:276/278 of query aligns to 8:282/284 of Q8LAS8
3fcxA Crystal structure of human esterase d (see paper)
51% identity, 100% coverage: 1:278/278 of query aligns to 3:268/268 of 3fcxA
P40363 S-formylglutathione hydrolase; FGH; EC 3.1.2.12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
40% identity, 100% coverage: 1:277/278 of query aligns to 1:297/299 of P40363
4flmA S-formylglutathione hydrolase w197i variant containing copper (see paper)
39% identity, 100% coverage: 1:277/278 of query aligns to 1:286/288 of 4flmA
4rotA Crystal structure of esterase a from streptococcus pyogenes
27% identity, 55% coverage: 19:171/278 of query aligns to 15:153/268 of 4rotA
Sites not aligning to the query:
>Synpcc7942_0458 FitnessBrowser__SynE:Synpcc7942_0458
MELLSSHRSFGGWQQRYGFKSTSLNSETTLSVYLPPQADRGSVPLLYWLSGLTCTDENFV
TKAGAQRAAAELGLAIAAPDTSPRGAAVADDAGWDLGQGAGFYVDATQDPWRSHYQMATY
VRDELPALLAAHFPAIDCDRAGISGHSMGGHGALTLALNNPDRYRSASAFAPIAAPSQCP
WGEKALTAYLGSDRSAWLTYDACECLKTSAWDRPILVDQGEADEFLAGQLLPQQLEQAAQ
AAGKALTLRYQPDYNHSYFFIASFIDDHLRFHAEQLGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory