SitesBLAST
Comparing Synpcc7942_0498 FitnessBrowser__SynE:Synpcc7942_0498 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P74285 UTP--glucose-1-phosphate uridylyltransferase; Cyanobacterial UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDP-Glc PPase; EC 2.7.7.9 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
34% identity, 41% coverage: 1:340/837 of query aligns to 1:350/388 of P74285
- A8 (≠ G8) mutation to G: Two-fold decrease in affinity for UTP. No effect on affinity for Glc-1P and on catalytic activity rate.
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
29% identity, 43% coverage: 1:364/837 of query aligns to 1:349/360 of 7d73E
- binding guanosine-5'-triphosphate: L6 (= L6), V7 (≠ A7), G8 (= G8), G9 (= G9), G11 (= G11), T12 (= T12), R13 (= R13), A52 (≠ T52), S54 (≠ Y54), E80 (= E79), P83 (= P83), G85 (= G85), N108 (≠ S105)
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
29% identity, 43% coverage: 1:364/837 of query aligns to 1:349/360 of 7d72K
- binding guanosine-5'-diphosphate-alpha-d-mannose: L6 (= L6), V7 (≠ A7), G8 (= G8), G85 (= G85), T86 (= T86), N108 (≠ S105), S109 (≠ G106), D110 (= D107), N172 (= N170), E194 (≠ A193), D218 (= D218)
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
29% identity, 43% coverage: 1:364/837 of query aligns to 1:349/360 of 7d72E
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
25% identity, 52% coverage: 383:820/837 of query aligns to 3:443/455 of 1wqaA
- active site: R11 (= R391), S101 (≠ D477), H102 (≠ P478), K111 (≠ E487), D243 (≠ A618), D245 (≠ N620), D247 (≠ E622), R248 (= R623), G330 (= G706), R340 (≠ F716)
- binding magnesium ion: S101 (≠ D477), D243 (≠ A618), D245 (≠ N620), D247 (≠ E622)
7x8kB Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
26% identity, 44% coverage: 1:366/837 of query aligns to 1:352/367 of 7x8kB
O22287 Mannose-1-phosphate guanylyltransferase 1; GDP-mannose pyrophosphorylase 1; Protein CYTOKINESIS DEFECTIVE 1; Protein EMBRYO DEFECTIVE 101; Protein HYPERSENSITIVE TO AMMONIUM ION 1; Protein SENSITIVE TO OZONE 1; Protein VITAMIN C DEFECTIVE 1; EC 2.7.7.13 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
26% identity, 44% coverage: 1:366/837 of query aligns to 1:352/361 of O22287
- L6 (= L6) binding
- V7 (≠ A7) binding
- G9 (= G9) binding
- G11 (= G11) binding ; mutation to S: In hsn1; reduced enzyme activity, ascorbate concentrations and N-glycosylation, and increased sensitivity to ammonium.
- T12 (= T12) binding
- R13 (= R13) binding
- P22 (= P22) mutation to S: In vtc1-1 and vtc1-2; reduced enzyme activity and ascorbate concentrations, and ozone-sensitive.
- K23 (= K23) binding
- D27 (≠ P27) mutation to E: Abolishes interaction with CSN5B and subsequent degradation in the dark by the 26S proteasome, and increases ascorbate accumulation in seedlings.
- G85 (= G85) binding
- P89 (≠ S89) mutation to L: In cyt1-1; deficient in N-glycosylation and cellulose, and embryo lethal.
- N109 (≠ S105) binding
- D111 (= D107) binding
- G146 (= G142) binding
- N173 (= N170) binding
Sites not aligning to the query:
- 223:361 mutation Missing: Reduces catalytic activity 3-fold.
7whsA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gtp (see paper)
30% identity, 40% coverage: 1:332/837 of query aligns to 1:342/366 of 7whsA
- binding guanosine-5'-triphosphate: L6 (= L6), V7 (≠ A7), G8 (= G8), G9 (= G9), G11 (= G11), R13 (= R13), A52 (≠ T52), G85 (= G85), N108 (≠ S105), D110 (= D107)
- binding magnesium ion: D110 (= D107), D218 (= D218)
7x8kA Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
26% identity, 44% coverage: 1:366/837 of query aligns to 1:351/365 of 7x8kA
- binding guanosine-5'-diphosphate-alpha-d-mannose: V7 (≠ A7), G8 (= G8), E80 (≠ A80), G85 (= G85), P89 (≠ S89), N109 (≠ S105), D111 (= D107), G146 (= G142), E162 (= E157), N172 (= N170), G174 (= G172), E194 (≠ A193)
7whtA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gdp-mannose (see paper)
31% identity, 40% coverage: 1:332/837 of query aligns to 1:336/360 of 7whtA
- binding guanosine-5'-diphosphate-alpha-d-mannose: L6 (= L6), V7 (≠ A7), G9 (= G9), G11 (= G11), K23 (= K23), P83 (= P83), L84 (= L84), N108 (≠ S105), S109 (≠ G106), D110 (= D107), E159 (= E157), N170 (= N170), E192 (≠ A193), W209 (= W216), D211 (= D218)
- binding magnesium ion: D110 (= D107), D211 (= D218)
7d72A Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
29% identity, 42% coverage: 1:352/837 of query aligns to 2:384/407 of 7d72A
- binding guanosine-5'-diphosphate-alpha-d-mannose: L7 (= L6), G9 (= G8), K13 (≠ L10), F58 (≠ Y54), E85 (= E79), G90 (= G85), N114 (≠ S105), K170 (= K158), N180 (= N170), E210 (≠ A193), Q234 (≠ D218), K236 (vs. gap)
7d73B Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
29% identity, 42% coverage: 1:352/837 of query aligns to 2:383/406 of 7d73B
5z09A St0452(y97n)-utp binding form (see paper)
26% identity, 51% coverage: 1:425/837 of query aligns to 1:392/401 of 5z09A
- binding uridine 5'-triphosphate: L6 (= L6), A7 (= A7), A8 (≠ G8), G9 (= G9), S10 (≠ L10), G11 (= G11), E12 (≠ T12), R13 (= R13), Q73 (≠ E79), G79 (= G85), G98 (= G106), D99 (= D107)
2ggqA Complex of hypothetical glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
26% identity, 51% coverage: 1:425/837 of query aligns to 1:392/401 of 2ggqA
- active site: R13 (= R13)
- binding thymidine-5'-triphosphate: L6 (= L6), A8 (≠ G8), G9 (= G9), S10 (≠ L10), G11 (= G11), E12 (≠ T12), R13 (= R13), K23 (= K23), Q73 (≠ E79), G79 (= G85), A83 (≠ S89), R179 (≠ P189), E181 (≠ D191), K344 (≠ N373)
Q975F9 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase; EC 2.7.7.24; EC 2.7.7.9; EC 2.7.7.83; EC 2.7.7.23; EC 2.3.1.276; EC 2.3.1.157 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
26% identity, 51% coverage: 1:425/837 of query aligns to 1:392/401 of Q975F9
- AGSGER 8:13 (≠ GGLGTR 8:13) binding
- Q73 (≠ E79) binding
- G79 (= G85) binding
- T80 (= T86) mutation T->A,G,Q: Increases both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->D,H: Decrease in GlcNAc-1-P UTase activity but increase in Glc-1-P UTase activity.; mutation T->E,K,L,M,R,W,Y: Strong decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.; mutation T->F,I: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->N,S: Strong increase in GlcNAc-1-P UTase activity and decrease in Glc-1-P UTase activity.; mutation to N: Loss of GlcNAc-1-P UTase activity; when associated with V-97.
- Y97 (≠ S105) mutation Y->A,D,F,G,I,K,T,V: Increases GlcNAc-1-P UTase activity. Decreases Glc-1-P UTase activity.; mutation Y->C,E,P,R,W: Decreases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation Y->H,L,M,N,Q,S: Increases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation to V: Loss of GlcNAc-1-P UTase activity; when associated with N-80.
- E146 (= E157) mutation E->A,C,F,G,I,K,L,M,P,Q,R,V,W,Y: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->D,N: Decrease in GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->H,S,T: Decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.
- H308 (≠ Q313) mutation to A: Strong decrease in GalN-1-P AcTase activity and almost loss of GlcN-1-P AcTase activity.
- Y311 (≠ H316) mutation to A: Strong decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- N331 (≠ E348) mutation to A: Strong decrease in GalN-1-P AcTase activity and decrease in GlcN-1-P AcTase activity.
- K337 (≠ A354) mutation to A: Slight decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- K340 (≠ R357) mutation to A: Decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
Sites not aligning to the query:
- 391:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 38% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 16.8 times. Significantly affects the thermostability of the entire protein.
- 397:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 20% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 4.8 times. Does not affect thermostability.
6jq8A Crystal structure of hddc from yersinia pseudotuberculosis complexed with gmp-pn (see paper)
30% identity, 27% coverage: 4:228/837 of query aligns to 5:220/225 of 6jq8A
- binding aminophosphonic acid-guanylate ester: L7 (= L6), A8 (= A7), G9 (= G8), G10 (= G9), S53 (≠ T52), E80 (= E79), P83 (= P83), G85 (= G85), A89 (≠ S89), N106 (≠ S105), D108 (= D107)
Q8Z5I4 Glucose-1-phosphate cytidylyltransferase; CDP-glucose pyrophosphorylase; EC 2.7.7.33 from Salmonella typhi (see 2 papers)
29% identity, 26% coverage: 1:216/837 of query aligns to 1:230/257 of Q8Z5I4
- K23 (= K23) binding
- S104 (≠ P83) binding
- R109 (≠ S89) binding
- G128 (= G106) binding
- D129 (= D107) binding
Sites not aligning to the query:
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
22% identity, 54% coverage: 384:837/837 of query aligns to 9:458/459 of 4il8A
- active site: R16 (= R391), S104 (≠ D477), H105 (≠ P478), K114 (vs. gap), D238 (≠ A618), D240 (≠ N620), D242 (≠ E622), R243 (= R623), A325 (≠ G706), D336 (vs. gap)
- binding magnesium ion: S104 (≠ D477), D238 (≠ A618), D240 (≠ N620), D242 (≠ E622)
1wvcA Alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp (see paper)
28% identity, 26% coverage: 2:216/837 of query aligns to 3:227/254 of 1wvcA
- binding cytidine-5'-triphosphate: L7 (= L6), A8 (= A7), G9 (= G8), G10 (= G9), G12 (= G11), T13 (= T12), R14 (= R13), K24 (= K23), S105 (≠ P83), R110 (≠ S89), G129 (= G106), D130 (= D107)
- binding magnesium ion: D130 (= D107)
Sites not aligning to the query:
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
22% identity, 54% coverage: 384:837/837 of query aligns to 5:454/455 of 2h5aX
- active site: H101 (≠ P478), D234 (≠ A618), D236 (≠ N620), D238 (≠ E622), R239 (= R623), D332 (vs. gap)
- binding 1-O-phosphono-alpha-D-xylopyranose: Y9 (≠ G388), T298 (= T683), G299 (≠ P684), H300 (≠ T685), E317 (≠ S702), S319 (≠ E704), H321 (≠ G706), R413 (≠ L796), S415 (≠ D798), N416 (≠ A799), T417 (≠ S800)
- binding zinc ion: S100 (≠ D477), D234 (≠ A618), D236 (≠ N620), D238 (≠ E622)
Query Sequence
>Synpcc7942_0498 FitnessBrowser__SynE:Synpcc7942_0498
MRAVLLAGGLGTRLRPLTCDRPKPMVPILNRPIAAHILQLLHRHGYQEILATLYYRPETI
QQYFQEGQDWGVDLRYILEADRPLGTAGSVKNLTSQLQETFLVASGDCLSDFDLTAALAW
HRQQQAIATVILARVDQPLEFGCVVCDRQQRIIRLIEKPDASELISDTVNSGFYILEPEA
LDYLPLDEPSDFATHLLPRLLAAGEVVTGYVDQGYWCDIGNRQAYQRAQLDALLGRVRLQ
ANQMEWRPGIYVGEGTTIASSAQLEPPLWIGQHCYIGEEVQLKAGTVIGDESRIEAGACL
DRAVVWNRVQIGQRSHLEGCVLADGVRLERHVQIHEGAVIGSGCRLQEEAQVQAEVRIWP
RKQIEAGAIVNLNLIWATSARRRLFSDGGVRGIANVDITPEFAVKLGVAYGSTIPPGSSV
TVSRDQRSISQMVTRSLIAGLMSTGITIRNLEAAAVPIARSMLARLPVVGGIHVRLDPLW
PTHVLIEFLDREGLTVDRALERRIEAAFFQEDLRRVPMQDLGTMITVSETLPLYRQLFCD
RLDRDLLLRSPNRIVIDYAYSVSGAVLPLLLSEFGCDAVILNASLRQQPPTENERQSLLE
QMGQVVSAIKANCGVQVAANGERFTLVDEQGMALDHEQLTVLMAEICWLRRPGGTVVVPM
TSSSAVDQTAWRYHGRVHRCRPTPTALMAACRNLPDVILGGSGELGFIFPEMHAGFDAIF
GIARLIEGLDRQSRSLSQWVESLPSIAHRHLTLSCPRNLLGTLMRQLLESHEPDRLNFQE
GLRIQGDRGDQWLLVLPDASYPLIHLYANAQDHQWVEQTLGSYQQQIEQFVATLQSP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory