SitesBLAST
Comparing Synpcc7942_0525 FitnessBrowser__SynE:Synpcc7942_0525 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
46% identity, 98% coverage: 4:363/368 of query aligns to 3:356/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
45% identity, 98% coverage: 4:363/368 of query aligns to 4:355/360 of 3okfA
- active site: R120 (= R124), K142 (= K146), E184 (= E188), K226 (= K232), R238 (= R246), N242 (= N250), H245 (= H253), H249 (= H257), H262 (= H270)
- binding nicotinamide-adenine-dinucleotide: N42 (= N46), L48 (≠ R52), D71 (≠ A75), E73 (= E77), K76 (= K80), G104 (= G108), G105 (= G109), V106 (= V110), D109 (= D113), T129 (= T133), T130 (≠ S134), L132 (= L136), D136 (= D140), T172 (= T176), L173 (= L177), E177 (= E181)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
45% identity, 98% coverage: 5:366/368 of query aligns to 84:443/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
45% identity, 98% coverage: 5:366/368 of query aligns to 4:363/365 of 3zokA
- active site: R122 (= R124), K144 (= K146), E186 (= E188), K228 (= K232), E238 (= E242), R242 (= R246), N246 (= N250), H249 (= H253), H253 (= H257), H266 (= H270)
- binding glycine: K144 (= K146), K228 (= K232), R242 (= R246)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ A48), V45 (≠ I49), D73 (≠ A75), E75 (= E77), K78 (= K80), G106 (= G108), G107 (= G109), V108 (= V110), D111 (= D113), T131 (= T133), T132 (≠ S134), M134 (≠ L136), D138 (= D140), S139 (≠ A141), K144 (= K146), K153 (= K155), T174 (= T176), L175 (= L177), E179 (= E181), H266 (= H270)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
44% identity, 98% coverage: 4:364/368 of query aligns to 4:360/363 of 6llaB
- active site: R121 (= R124), K143 (= K146), E185 (= E188), K227 (= K232), E237 (= E242), R242 (= R246), N246 (= N250), H249 (= H253), H253 (= H257), H266 (= H270)
- binding magnesium ion: E185 (= E188), H249 (= H253), H266 (= H270)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ I49), D72 (≠ A75), E74 (= E77), K77 (= K80), G105 (= G108), G106 (= G109), V107 (= V110), D110 (= D113), T130 (= T133), T131 (≠ S134), L133 (= L136), D137 (= D140), K143 (= K146), T173 (= T176), L174 (= L177), E178 (= E181)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
43% identity, 98% coverage: 4:364/368 of query aligns to 4:356/357 of 6lk2A
- active site: R121 (= R124), K143 (= K146), E185 (= E188), K227 (= K232), R238 (= R246), N242 (= N250), H245 (= H253), H249 (= H257), H262 (= H270)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D140), E185 (= E188), K227 (= K232), R238 (= R246), N242 (= N250), H245 (= H253), T246 (= T254), H249 (= H257), H262 (= H270)
- binding magnesium ion: E185 (= E188), H245 (= H253), H262 (= H270)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ I49), D72 (≠ A75), E74 (= E77), K77 (= K80), G105 (= G108), G106 (= G109), V107 (= V110), D110 (= D113), T130 (= T133), T131 (≠ S134), L133 (= L136), D137 (= D140), S138 (≠ A141), C170 (≠ T173), T173 (= T176), L174 (= L177), P175 (= P178), E178 (= E181)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
43% identity, 90% coverage: 34:363/368 of query aligns to 22:340/343 of P56081
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
44% identity, 87% coverage: 40:359/368 of query aligns to 36:353/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
43% identity, 87% coverage: 40:359/368 of query aligns to 39:348/354 of 5hvnA
- active site: R123 (= R124), K145 (= K146), E187 (= E188), K228 (= K232), R239 (= R246), N243 (= N250), H246 (= H253), H250 (= H257), H263 (= H270)
- binding nicotinamide-adenine-dinucleotide: N45 (= N46), L51 (≠ R52), D73 (≠ A75), E75 (= E77), K78 (= K80), G107 (= G108), G108 (= G109), V109 (= V110), D112 (= D113), T132 (= T133), T133 (≠ S134), L135 (= L136), D139 (= D140), K145 (= K146), F172 (≠ T173), T175 (= T176), L176 (= L177), E180 (= E181)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
44% identity, 89% coverage: 38:364/368 of query aligns to 34:351/355 of 5eksA
- active site: R120 (= R124), K142 (= K146), E184 (= E188), K226 (= K232), R237 (= R246), N241 (= N250), H244 (= H253), H248 (= H257), H261 (= H270)
- binding magnesium ion: E184 (= E188), H244 (= H253), H261 (= H270)
- binding nicotinamide-adenine-dinucleotide: N42 (= N46), V45 (≠ I49), D71 (≠ A75), E73 (= E77), K76 (= K80), G104 (= G108), G105 (= G109), V106 (= V110), D109 (= D113), T129 (= T133), T130 (≠ S134), D136 (= D140), S137 (≠ A141), K142 (= K146), T172 (= T176), L173 (= L177), E177 (= E181)
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
40% identity, 90% coverage: 34:363/368 of query aligns to 19:305/308 of 3clhA
- active site: R107 (= R124), K129 (= K146), E171 (= E188), K207 (= K232), R212 (= R246), N216 (= N250), H219 (= H253), H223 (= H257), H236 (= H270)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ A48), V34 (≠ I49), H38 (≠ Y53), S58 (≠ A75), E60 (= E77), K63 (= K80), G91 (= G108), G92 (= G109), V93 (= V110), D96 (= D113), T116 (= T133), T117 (≠ S134), L119 (= L136), D123 (= D140), A124 (= A141), K129 (= K146), N139 (= N156), T159 (= T176), L160 (= L177), E164 (= E181)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
45% identity, 74% coverage: 73:345/368 of query aligns to 72:365/1555 of 6hqvA
- active site: R123 (= R124), K145 (= K146), E187 (= E188), K243 (= K232), E253 (= E242), R257 (= R246), N261 (= N250), H264 (= H253), H268 (= H257), H280 (= H270)
- binding glutamic acid: D139 (= D140), K145 (= K146), E187 (= E188), K243 (= K232), R257 (= R246), H264 (= H253), H280 (= H270)
- binding nicotinamide-adenine-dinucleotide: E76 (= E77), K79 (= K80), G107 (= G108), G108 (= G109), V109 (= V110), D112 (= D113), T132 (= T133), T133 (≠ S134), L135 (= L136), D139 (= D140), S140 (≠ A141), K145 (= K146), K154 (= K155), T175 (= T176), L176 (= L177), P177 (= P178), E180 (= E181), H280 (= H270)
- binding zinc ion: E187 (= E188), H264 (= H253), H280 (= H270)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
47% identity, 73% coverage: 71:340/368 of query aligns to 69:334/362 of P9WPX9
Sites not aligning to the query:
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
45% identity, 73% coverage: 71:340/368 of query aligns to 64:325/352 of 3qbeA
- active site: R117 (= R124), K139 (= K146), E181 (= E188), K223 (= K232), R233 (= R246), N237 (= N250), H240 (= H253), H244 (= H257), H256 (= H270)
- binding zinc ion: E181 (= E188), H240 (= H253), H256 (= H270)
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
41% identity, 76% coverage: 37:314/368 of query aligns to 36:325/385 of 6c5cA
- active site: R130 (= R124), K152 (= K146), E194 (= E188), K246 (= K232), E254 (= E242), R258 (= R246), N262 (= N250), H265 (= H253), H269 (= H257), H281 (= H270)
- binding nicotinamide-adenine-dinucleotide: D45 (≠ N46), N47 (≠ A48), M48 (≠ I49), E83 (= E77), K86 (= K80), G114 (= G108), G115 (= G109), V116 (= V110), D119 (= D113), T139 (= T133), T140 (≠ S134), D146 (= D140), S147 (≠ A141), F179 (≠ T173), T182 (= T176), L183 (= L177), Q187 (≠ E181)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
40% identity, 84% coverage: 37:345/368 of query aligns to 35:372/1583 of P07547
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
41% identity, 84% coverage: 37:345/368 of query aligns to 32:362/381 of 1dqsA
- active site: R127 (= R124), K149 (= K146), E191 (= E188), K240 (= K232), E250 (= E242), R254 (= R246), N258 (= N250), H261 (= H253), H265 (= H257), H277 (= H270)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D140), K149 (= K146), N159 (= N156), E191 (= E188), K240 (= K232), R254 (= R246), L257 (= L249), N258 (= N250), H261 (= H253), H265 (= H257), H277 (= H270), K346 (= K329)
- binding nicotinamide-adenine-dinucleotide: D41 (≠ N46), N43 (≠ A48), I44 (= I49), E78 (= E77), K81 (= K80), G111 (= G108), G112 (= G109), V113 (= V110), D116 (= D113), T136 (= T133), T137 (≠ S134), L139 (= L136), D143 (= D140), S144 (≠ A141), K158 (= K155), T179 (= T176), P181 (= P178), E184 (= E181), H277 (= H270)
- binding zinc ion: E191 (= E188), H261 (= H253), H277 (= H270)
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
41% identity, 84% coverage: 37:345/368 of query aligns to 33:370/391 of 1nvbB
- active site: R128 (= R124), K150 (= K146), E192 (= E188), K248 (= K232), E258 (= E242), R262 (= R246), N266 (= N250), H269 (= H253), H273 (= H257), H285 (= H270)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D140), K150 (= K146), N160 (= N156), E192 (= E188), K248 (= K232), R262 (= R246), L265 (= L249), N266 (= N250), H269 (= H253), H273 (= H257), K354 (= K329)
- binding zinc ion: E192 (= E188), H269 (= H253), H285 (= H270)
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
32% identity, 99% coverage: 3:365/368 of query aligns to 1:349/353 of 1xagA
- active site: R115 (= R124), K136 (= K146), E178 (= E188), K221 (= K232), E231 (= E242), R235 (= R246), N239 (= N250), H242 (= H253), H246 (= H257), H256 (= H270)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K146), N146 (= N156), E178 (= E188), K221 (= K232), R235 (= R246), L238 (= L249), N239 (= N250), H242 (= H253), H246 (= H257), K314 (= K329)
- binding nicotinamide-adenine-dinucleotide: D39 (≠ N46), Y41 (≠ A48), V42 (≠ I49), Y45 (≠ R52), E68 (= E77), K71 (= K80), G99 (= G108), G100 (= G109), A101 (≠ V110), D104 (= D113), T124 (= T133), T125 (≠ S134), L127 (= L136), D130 (= D140), S131 (≠ A141), K136 (= K146), K145 (= K155), T166 (= T176), L167 (= L177), Q171 (≠ E181), H256 (= H270)
- binding zinc ion: E178 (= E188), H242 (= H253), H256 (= H270)
3qbdA 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with NAD
44% identity, 73% coverage: 71:340/368 of query aligns to 64:317/344 of 3qbdA
- active site: R117 (= R124), K139 (= K146), E181 (= E188), K223 (= K232), R232 (= R246), N236 (= N250), H239 (= H253), H243 (= H257), H255 (= H270)
- binding nicotinamide-adenine-dinucleotide: D68 (≠ A75), A69 (≠ G76), E70 (= E77), K73 (= K80), G101 (= G108), G102 (= G109), A103 (≠ V110), D106 (= D113), T126 (= T133), T127 (≠ S134), L129 (= L136), A134 (= A141), T169 (= T176), L170 (= L177)
Sites not aligning to the query:
Query Sequence
>Synpcc7942_0525 FitnessBrowser__SynE:Synpcc7942_0525
MSVQIPVALPQNAYEIAIANGGLAAAGTWLQQADLKAGTKLLIVTNPAIGRRYGDRLVAA
LQEAGFIVDCLTLPAGERYKTPATVQRIYDKALELRLERRSALVALGGGVIGDMTGFAAA
TWLRGISFVQIPTSLLAMVDASIGGKTGVNHPRGKNLIGAFHQPKLVLIDPETLQTLPVR
EFRAGMAEVIKYGVIWDRDLFERLEASPFLDRPRSLPANLLTLILERSCRAKAEVVAKDE
KESGLRAILNYGHTIGHAVESLTGYRIVNHGEAVAIGMVAAGRLAVALGLWNQDECDRQE
AVIAKAGLPTRLPEGIDQAAIVEALQLDKKVQAGKVRFILPTTLGHVTITDQVPSQTLQE
VLQAIANP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory