Comparing Synpcc7942_0526 FitnessBrowser__SynE:Synpcc7942_0526 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
34% identity, 90% coverage: 5:269/293 of query aligns to 27:288/313 of P94529
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
26% identity, 98% coverage: 5:291/293 of query aligns to 5:284/285 of 7cagA
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 80% coverage: 51:285/293 of query aligns to 259:507/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
28% identity, 86% coverage: 32:283/293 of query aligns to 224:490/490 of 4ki0F
>Synpcc7942_0526 FitnessBrowser__SynE:Synpcc7942_0526
MTALRDRLSPYLFLAPALTILGLTVFWPALQAFYFSFTRFDYNLTRSPQWVGLENFQRLL
NDAVFWKTLGNTFIYLIGVVPLLVFLPLGLAILVNRPLRGITLFRLAYYTPVIVSIVVAG
IAWRWLYAETGLLNQLGQLVFGEGFQPIPWLTSPALALFSVMAVTVWKGLGYYMVIYLAG
LQGIPLELYEAAALDGSDGWRRHLDITLPLMRPYLVLVAVISAISATKVFEEVFIMTQGG
PLNSSKTVVYYVYQQAFQKLEVSYACTVGLALFLVVLTLSLLRLRFGASDPVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory