SitesBLAST
Comparing Synpcc7942_0534 FitnessBrowser__SynE:Synpcc7942_0534 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
44% identity, 100% coverage: 2:641/641 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N100), G99 (= G101), Y248 (≠ F258), E481 (= E516), K485 (= K520), E488 (= E523), H504 (= H539), K603 (= K636)
- binding fructose -6-phosphate: G301 (= G327), T302 (= T328), S303 (= S329), S347 (≠ T373), Q348 (= Q374), S349 (= S375), T352 (= T378), S401 (≠ A434), K485 (= K520), E488 (= E523)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
44% identity, 100% coverage: 2:641/641 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N100), G99 (= G101), Y248 (≠ F258), E481 (= E516), K485 (= K520), E488 (= E523), H504 (= H539), K603 (= K636)
- binding glucose-6-phosphate: T302 (= T328), S303 (= S329), S347 (≠ T373), Q348 (= Q374), S349 (= S375), T352 (= T378), S401 (≠ A434), K485 (= K520), E488 (= E523)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
44% identity, 100% coverage: 2:641/641 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N100), G99 (= G101), Y248 (≠ F258), E481 (= E516), K485 (= K520), E488 (= E523), H504 (= H539), K603 (= K636)
- binding glucose-6-phosphate: T302 (= T328), S347 (≠ T373), Q348 (= Q374), S349 (= S375), T352 (= T378), V399 (= V432), S401 (≠ A434), E488 (= E523)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N100), G99 (= G101), D123 (= D125)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
33% identity, 100% coverage: 2:641/641 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N100), G123 (= G101), E533 (= E516), K537 (= K520), E540 (= E523), H556 (= H539), K655 (= K636)
- binding glucose-6-phosphate: C353 (= C326), T355 (= T328), S356 (= S329), S400 (≠ T373), Q401 (= Q374), S402 (= S375), T405 (= T378), S453 (≠ A434), K537 (= K520), E540 (= E523)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), H107 (= H86), G123 (= G101), D147 (= D125)
- binding magnesium ion: S434 (≠ A415), R435 (≠ H416), T437 (≠ V418)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ S250), R322 (≠ H280), G334 (≠ N309), G424 (= G405), T426 (= T407), S434 (≠ A415), T437 (≠ V418), C439 (≠ H420), G440 (≠ I421), V441 (≠ L422), H442 (≠ D423)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
33% identity, 100% coverage: 2:641/641 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N100), G123 (= G101), E536 (= E516), K540 (= K520), E543 (= E523), H559 (= H539), K658 (= K636)
- binding glucose-6-phosphate: T358 (= T328), S359 (= S329), S403 (≠ T373), Q404 (= Q374), S405 (= S375), T408 (= T378), S456 (≠ A434), K540 (= K520), E543 (= E523)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), G123 (= G101), D147 (= D125)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
33% identity, 99% coverage: 2:634/641 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N100), G123 (= G101), E532 (= E516), K536 (= K520), E539 (= E523), H555 (= H539)
- binding glucose-6-phosphate: G353 (= G327), T354 (= T328), S355 (= S329), S399 (≠ T373), Q400 (= Q374), S401 (= S375), T404 (= T378), S452 (≠ A434), E539 (= E523)
- binding magnesium ion: S433 (≠ A415), R434 (≠ H416), T436 (≠ V418)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ S250), R321 (≠ H280), G333 (≠ N309), G423 (= G405), T425 (= T407), S433 (≠ A415), T436 (≠ V418), C438 (≠ H420), G439 (≠ I421), V440 (≠ L422), H441 (≠ D423)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
32% identity, 100% coverage: 1:641/641 of query aligns to 1:699/699 of Q06210
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 100% coverage: 1:641/641 of query aligns to 1:717/717 of P14742
- M1 (= M1) modified: Initiator methionine, Removed
- C2 (= C2) active site, For GATase activity
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
44% identity, 61% coverage: 254:641/641 of query aligns to 3:367/367 of 1mosA
- active site: E240 (= E516), K244 (= K520), E247 (= E523), H263 (= H539), K362 (= K636)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T328), S62 (= S329), S106 (≠ T373), Q107 (= Q374), S108 (= S375), T111 (= T378), K244 (= K520), E247 (= E523)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
44% identity, 61% coverage: 254:641/641 of query aligns to 2:366/366 of 1morA
- active site: E239 (= E516), K243 (= K520), E246 (= E523), H262 (= H539), K361 (= K636)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T328), S105 (≠ T373), Q106 (= Q374), S107 (= S375), T110 (= T378), V157 (= V432), A360 (= A635), K361 (= K636)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
44% identity, 61% coverage: 254:641/641 of query aligns to 2:366/366 of 1moqA
- active site: E239 (= E516), K243 (= K520), E246 (= E523), H262 (= H539), K361 (= K636)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T328), S61 (= S329), S105 (≠ T373), Q106 (= Q374), S107 (= S375), T110 (= T378), V157 (= V432), A360 (= A635), K361 (= K636)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
42% identity, 59% coverage: 254:632/641 of query aligns to 2:357/357 of 7dnrA
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
36% identity, 60% coverage: 255:641/641 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E516), K242 (= K520), E245 (= E523), H261 (= H539), K360 (= K636)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T328), S61 (= S329), S105 (≠ T373), Q106 (= Q374), S107 (= S375), T110 (= T378), V156 (= V432), A157 (= A433), K242 (= K520), E245 (= E523)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
36% identity, 60% coverage: 255:641/641 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E516), K242 (= K520), E245 (= E523), H261 (= H539), K360 (= K636)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T328), S61 (= S329), S105 (≠ T373), Q106 (= Q374), S107 (= S375), T110 (= T378), V156 (= V432), A359 (= A635), K360 (= K636)
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
34% identity, 59% coverage: 255:629/641 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E516), K241 (= K520), E244 (= E523), H260 (= H539)
- binding fructose -6-phosphate: T59 (= T328), S60 (= S329), S104 (≠ T373), Q105 (= Q374), S106 (= S375), T109 (= T378), A156 (= A433), S157 (≠ A434), K241 (= K520), E244 (= E523)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
33% identity, 58% coverage: 258:629/641 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E516), K240 (= K520), E243 (= E523), H259 (= H539)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C326), T57 (= T328), S58 (= S329), S102 (≠ T373), Q103 (= Q374), S104 (= S375), T107 (= T378), E243 (= E523)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (vs. gap), G36 (≠ V272), G126 (= G405), V128 (≠ T407), S136 (≠ A415), T139 (≠ V418), C141 (≠ H420), G142 (≠ I421), V143 (≠ L422), H144 (≠ D423)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
45% identity, 38% coverage: 2:242/641 of query aligns to 1:232/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N100), G99 (= G101)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N100), G99 (= G101), D123 (= D125)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
45% identity, 38% coverage: 2:242/641 of query aligns to 1:232/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N100), G99 (= G101)
- binding glutamic acid: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N100), G99 (= G101), D123 (= D125)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
32% identity, 58% coverage: 258:629/641 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E516), K240 (= K520), E243 (= E523)
- binding fructose -6-phosphate: C55 (= C326), T57 (= T328), S102 (≠ T373), Q103 (= Q374), S104 (= S375), T107 (= T378), A154 (= A433), S155 (≠ A434), K240 (= K520)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (vs. gap), G36 (≠ V272), G126 (= G405), V128 (≠ T407), S136 (≠ A415), T139 (≠ V418), C141 (≠ H420), G142 (≠ I421), V143 (≠ L422), H144 (≠ D423)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
32% identity, 58% coverage: 258:629/641 of query aligns to 3:338/338 of 2puvA
- active site: E237 (= E516), K241 (= K520), E244 (= E523)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C326), T58 (= T328), S103 (≠ T373), Q104 (= Q374), S105 (= S375), T108 (= T378), A155 (= A433), E244 (= E523)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (vs. gap), G37 (≠ V272), G127 (= G405), V129 (≠ T407), S137 (≠ A415), T140 (≠ V418), C142 (≠ H420), G143 (≠ I421), V144 (≠ L422), H145 (≠ D423)
Query Sequence
>Synpcc7942_0534 FitnessBrowser__SynE:Synpcc7942_0534
MCGIVGYIGTQPASHILLEGLRQLEYRGYDSAGIATLWDHQLQIVRAEGKLHNLQAALQN
HDSPAHLGIGHTRWATHGKPEVRNAHPHKDMSGLVAVVQNGIVENYRELREALQAEGIEF
VSDTDTEVIPNLVARHFRQLAAAGSAPDSRLLEAVRLAVQELEGAYAIAVLCVDAPDEIV
VARQQAPLVIGFGQGEFFCASDTPAIINHTRAVVTLENGEMARLTPLGVEIFNFQGDRLR
KQPRLLSGTSLLAEKQGFRHYMLKEIYDQPGVVRSWLSTHLNDNWRADAADEPAQVAPYP
HAQTPVILNLPDELLNDLEQVQILACGTSWHASLVGRYLLETLAGVPTQVYYASEFRYAP
SPLVRNTLTIGVTQSGETADTLAALEKEGERRSGLGPEFAPRLLGITNRSESTLAHVVPH
ILDIQAGIEVGVAATKTFLGQVLAFYGLAIDLAYRRSSQSHEKLEALIAGLKRIPDQIEQ
LLREQDGAIESLAHQFTETQDFIFMGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHG
PIALLDSKVPVVAIAVPGSVYDKVLSNAQEAKARDARMIGVIPDGPDANMFDHYLWVPIV
DELLSPLLTVVPLQLLSYHIAALRGLDVDQPRNLAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory