Comparing Synpcc7942_0564 FitnessBrowser__SynE:Synpcc7942_0564 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
39% identity, 93% coverage: 6:225/237 of query aligns to 3:221/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
39% identity, 93% coverage: 6:225/237 of query aligns to 3:221/592 of 5lj7A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 97% coverage: 6:236/237 of query aligns to 4:230/648 of P75831
7mdyC Lolcde nucleotide-bound
43% identity, 91% coverage: 11:225/237 of query aligns to 7:221/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
43% identity, 91% coverage: 11:225/237 of query aligns to 10:224/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
43% identity, 91% coverage: 11:225/237 of query aligns to 7:221/222 of 7arlD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
41% identity, 92% coverage: 6:222/237 of query aligns to 3:218/226 of 5xu1B
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
43% identity, 91% coverage: 11:225/237 of query aligns to 9:223/229 of 7v8iD
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 97% coverage: 6:234/237 of query aligns to 1:229/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 97% coverage: 6:234/237 of query aligns to 2:230/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 97% coverage: 6:234/237 of query aligns to 2:230/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 97% coverage: 6:234/237 of query aligns to 2:230/344 of 6cvlD
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
35% identity, 92% coverage: 6:224/237 of query aligns to 1:223/232 of 1f3oA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 90% coverage: 24:237/237 of query aligns to 15:227/240 of 4ymuJ
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 98% coverage: 5:237/237 of query aligns to 1:227/241 of 4u00A
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
34% identity, 92% coverage: 6:224/237 of query aligns to 1:223/230 of 1l2tA
8g4cB Bceabs atpgs high res tm (see paper)
34% identity, 90% coverage: 16:228/237 of query aligns to 13:229/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
33% identity, 90% coverage: 16:228/237 of query aligns to 12:228/245 of 7tchB
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
40% identity, 92% coverage: 6:223/237 of query aligns to 4:214/216 of 7w79A
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
40% identity, 92% coverage: 6:223/237 of query aligns to 4:214/218 of 7w78A
>Synpcc7942_0564 FitnessBrowser__SynE:Synpcc7942_0564
MSSDAVVSIRNLDHFYGHDSLQKQVLFDVGFDLNPGEIVLLTGPSGCGKTTLLTLIGGLR
SVQAGTLSVLGQELHGASQRQRVEVRRNIGYIFQAHNLLRFLTASQNVQMTLDLQADLNW
DERIARSHQMLEAVGLGDHLDYYPENLSGGQKQRVAIARALVGRPKLVLADEPTAALDRQ
SGRDVVDLMQQLAKEQGCTILLVTHDNRILDIADRILEMEDGRLVKGGLTSPVLQKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory