SitesBLAST
Comparing Synpcc7942_0588 Synpcc7942_0588 phosphoribosylglycinamide formyltransferase 2 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
56% identity, 97% coverage: 10:389/391 of query aligns to 14:391/392 of P33221
- EL 22:23 (= EL 18:19) binding
- E82 (= E78) binding
- R114 (= R110) binding
- K155 (= K151) binding
- SSGKGQ 160:165 (= SSGKGQ 156:161) binding
- G162 (= G158) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ D175) modified: N6-acetyllysine
- EGVV 195:198 (≠ EEFI 191:194) binding
- E203 (= E199) binding
- E267 (= E264) binding
- E279 (= E276) binding
- D286 (= D283) binding
- K355 (= K353) binding
- RR 362:363 (= RR 360:361) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
56% identity, 97% coverage: 10:389/391 of query aligns to 13:388/389 of 1kjiA
- active site: E114 (≠ D111), K154 (= K151), S159 (= S156), G161 (= G158), E264 (= E264), E276 (= E276), D283 (= D283), T284 (= T284), R360 (= R361)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R110), I152 (≠ V149), K154 (= K151), S159 (= S156), S160 (= S157), G161 (= G158), Q164 (= Q161), E192 (= E191), V195 (≠ I194), E200 (= E199), Q222 (= Q222), E264 (= E264), F266 (= F266), E276 (= E276)
- binding magnesium ion: E264 (= E264), E276 (= E276)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
56% identity, 97% coverage: 10:389/391 of query aligns to 13:388/389 of 1ez1A
- active site: E114 (≠ D111), K154 (= K151), S159 (= S156), G161 (= G158), E264 (= E264), E276 (= E276), D283 (= D283), T284 (= T284), R360 (= R361)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R110), I152 (≠ V149), K154 (= K151), S159 (= S156), S160 (= S157), G161 (= G158), E192 (= E191), V194 (≠ F193), V195 (≠ I194), F197 (= F196), E200 (= E199), Q222 (= Q222), E264 (= E264), F266 (= F266), E276 (= E276)
- binding glycinamide ribonucleotide: G20 (= G17), E21 (= E18), L22 (= L19), E81 (= E78), I82 (= I79), S160 (= S157), D283 (= D283), K352 (= K353), R359 (= R360), R360 (= R361)
- binding magnesium ion: E264 (= E264), E276 (= E276)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
56% identity, 97% coverage: 10:389/391 of query aligns to 13:388/389 of 1eyzA
- active site: E114 (≠ D111), K154 (= K151), S159 (= S156), G161 (= G158), E264 (= E264), E276 (= E276), D283 (= D283), T284 (= T284), R360 (= R361)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R110), I152 (≠ V149), K154 (= K151), S159 (= S156), S160 (= S157), G161 (= G158), Q164 (= Q161), E192 (= E191), V195 (≠ I194), F197 (= F196), E200 (= E199), E264 (= E264), F266 (= F266), E276 (= E276)
- binding magnesium ion: E264 (= E264), E276 (= E276)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
56% identity, 97% coverage: 10:389/391 of query aligns to 13:385/386 of 1kjjA
- active site: E114 (≠ D111), K154 (= K151), S159 (= S156), G161 (= G158), E261 (= E264), E273 (= E276), D280 (= D283), T281 (= T284), R357 (= R361)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R110), I152 (≠ V149), K154 (= K151), S159 (= S156), S160 (= S157), G161 (= G158), Q164 (= Q161), E189 (= E191), V192 (≠ I194), E197 (= E199), Q219 (= Q222), E261 (= E264), F263 (= F266), E273 (= E276)
- binding magnesium ion: E261 (= E264), E273 (= E276)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
56% identity, 97% coverage: 10:389/391 of query aligns to 13:385/386 of 1kj8A
- active site: E114 (≠ D111), K154 (= K151), S159 (= S156), G161 (= G158), E261 (= E264), E273 (= E276), D280 (= D283), T281 (= T284), R357 (= R361)
- binding adenosine-5'-triphosphate: R113 (= R110), I152 (≠ V149), K154 (= K151), S159 (= S156), S160 (= S157), G161 (= G158), Q164 (= Q161), E189 (= E191), V192 (≠ I194), F194 (= F196), E197 (= E199), Q219 (= Q222), G222 (= G225), E261 (= E264), F263 (= F266), E273 (= E276)
- binding glycinamide ribonucleotide: G20 (= G17), E21 (= E18), L22 (= L19), E81 (= E78), I82 (= I79), S160 (= S157), D280 (= D283), K349 (= K353), R356 (= R360)
- binding magnesium ion: E261 (= E264), E273 (= E276)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
55% identity, 97% coverage: 10:389/391 of query aligns to 13:387/388 of 1kjqA
- active site: E114 (≠ D111), K154 (= K151), E263 (= E264), E275 (= E276), D282 (= D283), T283 (= T284), R359 (= R361)
- binding adenosine-5'-diphosphate: R113 (= R110), I152 (≠ V149), K154 (= K151), E191 (= E191), V193 (≠ F193), V194 (≠ I194), F196 (= F196), E199 (= E199), Q221 (= Q222), F265 (= F266), E275 (= E276)
- binding magnesium ion: E263 (= E264), E275 (= E276)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
47% identity, 97% coverage: 9:389/391 of query aligns to 17:411/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
46% identity, 97% coverage: 9:389/391 of query aligns to 19:400/409 of 2dwcB
- active site: E265 (= E264), E277 (= E276), D284 (= D283), T285 (= T284), R372 (= R361)
- binding adenosine-5'-diphosphate: R120 (= R110), H159 (≠ V149), K161 (= K151), H190 (≠ F193), I191 (= I194), F193 (= F196), E196 (= E199), F267 (= F266), E277 (= E276)
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
28% identity, 93% coverage: 24:388/391 of query aligns to 17:357/360 of 3ax6A
- active site: E231 (= E264), E244 (= E276), N251 (≠ D283), S252 (≠ T284), K330 (≠ R361)
- binding adenosine-5'-diphosphate: K101 (≠ R110), V136 (= V149), K138 (= K151), E164 (= E191), F166 (= F193), V167 (≠ I194), E172 (= E199), F233 (= F266), N243 (≠ S275)
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 93% coverage: 18:379/391 of query aligns to 19:367/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (= R110), K148 (= K151), Y154 (vs. gap), D155 (≠ S157), G156 (= G158), Q159 (= Q161), E183 (= E191), W185 (≠ F193), V186 (≠ I194), F188 (= F196), E191 (= E199), H214 (≠ Q222), N217 (≠ G225), E256 (= E264), F258 (= F266), E269 (= E276)
- binding carbonate ion: R273 (= R280), H275 (= H282), N276 (≠ D283)
- binding magnesium ion: T105 (= T107), E111 (≠ I113), E256 (= E264), E269 (= E276), L270 (= L277)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 93% coverage: 18:379/391 of query aligns to 18:366/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (= R110), K147 (= K151), Q158 (= Q161), W184 (≠ F193), V185 (≠ I194), F187 (= F196), E190 (= E199), N216 (≠ G225), F257 (= F266), N267 (≠ S275), E268 (= E276)
- binding 5-aminoimidazole ribonucleotide: Q18 (≠ E18), L19 (= L19), E76 (= E78), Y153 (vs. gap), R272 (= R280), K340 (= K353), R347 (= R360)
Sites not aligning to the query:
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 93% coverage: 18:379/391 of query aligns to 18:366/380 of 4dlkA
- active site: Y153 (vs. gap), G155 (= G158), E255 (= E264), E268 (= E276), N275 (≠ D283), S276 (≠ T284), K348 (≠ R361)
- binding adenosine-5'-triphosphate: E76 (= E78), F77 (≠ I79), R107 (= R110), K147 (= K151), Y153 (vs. gap), D154 (≠ S157), G155 (= G158), Q158 (= Q161), W184 (≠ F193), V185 (≠ I194), F187 (= F196), E190 (= E199), E255 (= E264), F257 (= F266), N267 (≠ S275), E268 (= E276), R272 (= R280), H274 (= H282), N275 (≠ D283), K340 (= K353), R347 (= R360), K348 (≠ R361)
- binding calcium ion: E255 (= E264), E268 (= E276)
- binding phosphate ion: Q47 (= Q47), A49 (= A49)
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 93% coverage: 18:379/391 of query aligns to 18:366/377 of 3q2oB
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 93% coverage: 18:379/391 of query aligns to 17:365/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (= R110), K146 (= K151), Y152 (vs. gap), G154 (= G158), Q157 (= Q161), W183 (≠ F193), V184 (≠ I194), E189 (= E199), N215 (≠ G225), F256 (= F266), N266 (≠ S275), E267 (= E276)
- binding carbonate ion: R271 (= R280), H273 (= H282), N274 (≠ D283)
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
30% identity, 93% coverage: 23:386/391 of query aligns to 14:357/360 of 3aw8A
- active site: E240 (= E264), E252 (= E276), N259 (≠ D283), S260 (≠ T284), K329 (≠ R361)
- binding adenosine monophosphate: L135 (≠ V149), K137 (= K151), Q142 (= Q161), F168 (= F193), V169 (≠ I194), E174 (= E199), H197 (≠ Q222), F242 (= F266), E252 (= E276)
4ma0A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with partially hydrolysed atp
26% identity, 84% coverage: 10:339/391 of query aligns to 2:317/366 of 4ma0A
- active site: Y144 (≠ S156), G146 (= G158), E247 (= E264), E259 (= E276), N266 (≠ D283), S267 (≠ T284)
- binding adenosine monophosphate: I136 (≠ V149), K138 (= K151), E175 (= E191), A176 (≠ E192), F177 (= F193), V178 (≠ I194), E183 (= E199), H206 (≠ Q222), F249 (= F266), E259 (= E276)
Sites not aligning to the query:
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
26% identity, 84% coverage: 10:339/391 of query aligns to 2:317/365 of 5jqwA
- active site: Y144 (≠ S156), G146 (= G158), E247 (= E264), E259 (= E276), N266 (≠ D283), S267 (≠ T284)
- binding adenosine-5'-diphosphate: R98 (= R112), K138 (= K151), G143 (≠ S155), Y144 (≠ S156), D145 (≠ S157), G146 (= G158), V178 (≠ I194), E183 (= E199), H206 (≠ Q222), F249 (= F266), E259 (= E276)
Sites not aligning to the query:
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
26% identity, 84% coverage: 10:339/391 of query aligns to 2:317/373 of 4mamA
- active site: Y144 (≠ S156), G146 (= G158), E247 (= E264), E259 (= E276), N266 (≠ D283), S267 (≠ T284)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R112), I136 (≠ V149), K138 (= K151), Y144 (≠ S156), G146 (= G158), Q149 (= Q161), E175 (= E191), F177 (= F193), V178 (≠ I194), F180 (= F196), E183 (= E199), H206 (≠ Q222), F249 (= F266), E259 (= E276)
Sites not aligning to the query:
4ma5A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an atp analog, amp-pnp.
26% identity, 84% coverage: 10:339/391 of query aligns to 2:315/363 of 4ma5A
- active site: Y144 (≠ S156), G146 (= G158), E247 (= E264), E257 (= E276), N264 (≠ D283), S265 (≠ T284)
- binding phosphoaminophosphonic acid-adenylate ester: I136 (≠ V149), K138 (= K151), D145 (≠ S157), G146 (= G158), F177 (= F193), V178 (≠ I194), E183 (= E199), H206 (≠ Q222), E247 (= E264), F249 (= F266), N256 (≠ S275), E257 (= E276), H263 (= H282)
Sites not aligning to the query:
Query Sequence
>Synpcc7942_0588 Synpcc7942_0588 phosphoribosylglycinamide formyltransferase 2
MTFADRLPRRLMLLGSGELGKEFAIAAQRLGNTVIAVDRYAHAPAMQVADASAVISMLDG
EALEAVVQEFQPDLIIPEIEAIRTEKLQEFEDRGLTVIPTARATHFTMNRDRIRDLAAQQ
LGLRTARYAYASCFEELQTVAAAIGYPNVIKPVMSSSGKGQSIIQQPDQLQAAWDYAIAG
SRGDSQKVILEEFIPFELEITLLTIRQWQGPTLFCPPIGHRQERGDYQESWQPAPLRPDL
LAQAQAIAAQVTEALGGAGLFGVEFFVTPDEVIFSELSPRPHDTGMVTLISQNLNEFELH
LRAVLGLPIPAIELLGPSASRVILAEDSGDRPSYAGVAAALQEPWVDLRLFGKPDMRPQR
RMGVALARDESVEAARAKADRAASQVTIQPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory