SitesBLAST
Comparing Synpcc7942_0592 FitnessBrowser__SynE:Synpcc7942_0592 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
38% identity, 86% coverage: 3:313/360 of query aligns to 1:293/319 of 1mtoA
- active site: G11 (= G13), R72 (≠ N80), C73 (vs. gap), D103 (= D109), G104 (= G110), G124 (≠ K131), T125 (= T132), D127 (= D134), D129 (= D136), R171 (= R178)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D134), R162 (= R169), M169 (= M176), R171 (= R178), E222 (= E230), R243 (= R263), H249 (= H269), R252 (= R272)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
38% identity, 86% coverage: 3:313/360 of query aligns to 1:293/319 of 6pfkA
- active site: G11 (= G13), R72 (≠ N80), C73 (vs. gap), D103 (= D109), G104 (= G110), G124 (≠ K131), T125 (= T132), D127 (= D134), D129 (= D136), R171 (= R178)
- binding 2-phosphoglycolic acid: R21 (= R23), R25 (= R27), G58 (≠ D66), D59 (≠ P67), R154 (≠ G161), R211 (= R218), K213 (≠ R221)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
38% identity, 86% coverage: 3:313/360 of query aligns to 1:293/319 of P00512
- RSVVR 21:25 (≠ RAIAR 23:27) binding
- D59 (≠ P67) binding
- RC 72:73 (≠ N- 80) binding
- D103 (= D109) binding
- TID 125:127 (= TID 132:134) binding in other chain
- R154 (≠ G161) binding in other chain
- R162 (= R169) binding
- MGR 169:171 (= MGR 176:178) binding in other chain
- GAE 185:187 (≠ GAD 192:194) binding in other chain
- R211 (= R218) binding in other chain
- KKH 213:215 (≠ RRY 221:223) binding in other chain
- E222 (= E230) binding in other chain
- R243 (= R263) binding
- HVQR 249:252 (= HVQR 269:272) binding in other chain
4pfkA Phosphofructokinase. Structure and control (see paper)
38% identity, 86% coverage: 3:313/360 of query aligns to 1:293/319 of 4pfkA
- active site: G11 (= G13), R72 (≠ N80), C73 (vs. gap), D103 (= D109), G104 (= G110), G124 (≠ K131), T125 (= T132), D127 (= D134), D129 (= D136), R171 (= R178)
- binding adenosine-5'-diphosphate: S9 (= S11), Y41 (≠ T44), R72 (≠ N80), C73 (vs. gap), F76 (≠ G82), K77 (≠ D83), G104 (= G110), G108 (≠ I114), R154 (≠ G161), G185 (= G192), R211 (= R218), G212 (≠ W219), K213 (≠ R221), H215 (≠ Y223)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D134), M169 (= M176), E222 (= E230), H249 (= H269), R252 (= R272)
- binding magnesium ion: G185 (= G192), E187 (≠ D194)
3pfkA Phosphofructokinase. Structure and control (see paper)
38% identity, 86% coverage: 3:313/360 of query aligns to 1:293/319 of 3pfkA
- active site: G11 (= G13), R72 (≠ N80), C73 (vs. gap), D103 (= D109), G104 (= G110), G124 (≠ K131), T125 (= T132), D127 (= D134), D129 (= D136), R171 (= R178)
- binding phosphate ion: R154 (≠ G161), K213 (≠ R221), H249 (= H269), R252 (= R272)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
38% identity, 86% coverage: 3:313/360 of query aligns to 1:293/319 of 4i4iA
- active site: G11 (= G13), R72 (≠ N80), C73 (vs. gap), D103 (= D109), G104 (= G110), G124 (≠ K131), T125 (= T132), D127 (= D134), D129 (= D136), R171 (= R178)
- binding phosphoenolpyruvate: R21 (= R23), R25 (= R27), G58 (≠ D66), R154 (≠ G161), R211 (= R218), K213 (≠ R221), H215 (≠ Y223)
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
38% identity, 86% coverage: 3:312/360 of query aligns to 2:293/320 of 1pfkA
- active site: G12 (= G13), R73 (≠ N80), F74 (vs. gap), D104 (= D109), G105 (= G110), G125 (≠ K131), T126 (= T132), D128 (= D134), D130 (= D136), R172 (= R178)
- binding adenosine-5'-diphosphate: G11 (= G12), R22 (= R23), R26 (= R27), Y56 (≠ Q63), S59 (≠ D66), D60 (≠ P67), R73 (≠ N80), F74 (vs. gap), F77 (vs. gap), R78 (= R81), G103 (= G108), D104 (= D109), G105 (= G110), S106 (= S111), M108 (≠ A113), G109 (≠ I114), R155 (≠ G161), G213 (≠ W219), K214 (≠ R221), H216 (≠ Y223)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G13), R73 (≠ N80), T126 (= T132), D128 (= D134), M170 (= M176), E223 (≠ H233), H250 (= H269), R253 (= R272)
- binding magnesium ion: G186 (= G192), E188 (≠ D194)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 86% coverage: 3:312/360 of query aligns to 2:293/320 of P0A796
- G12 (= G13) binding
- RGVVR 22:26 (≠ RAIAR 23:27) binding
- RYSVSD 55:60 (≠ RQSLDP 62:67) binding
- RF 73:74 (≠ N- 80) binding
- GDGS 103:106 (= GDGS 108:111) binding
- D104 (= D109) binding
- TID 126:128 (= TID 132:134) binding in other chain
- D128 (= D134) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (≠ G161) binding in other chain
- R163 (= R169) binding
- R172 (= R178) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GAD 192:194) binding in other chain
- KKH 214:216 (≠ RRY 221:223) binding in other chain
- E223 (≠ H233) binding in other chain
- R244 (= R263) binding
- HIQR 250:253 (≠ HVQR 269:272) binding in other chain
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
34% identity, 88% coverage: 3:319/360 of query aligns to 1:301/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S11), Y41 (≠ T44), C73 (≠ R81), F76 (≠ T84), K77 (≠ L85), G102 (= G108), D103 (= D109), G104 (= G110), S105 (= S111), R107 (≠ A113), G108 (≠ I114)
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
34% identity, 88% coverage: 3:319/360 of query aligns to 1:301/318 of 5xz6A
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
34% identity, 88% coverage: 3:319/360 of query aligns to 1:301/322 of 5xz7A
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
34% identity, 88% coverage: 3:319/360 of query aligns to 1:301/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
34% identity, 88% coverage: 3:319/360 of query aligns to 1:301/322 of Q2FXM8
- RC 72:73 (≠ NR 80:81) binding
- GDGS 102:105 (= GDGS 108:111) binding
- TID 127:129 (= TID 132:134) binding in other chain
- G150 (≠ E155) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A156) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R169) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 176:178) binding in other chain
- E224 (= E230) binding in other chain
- R245 (= R263) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (= HVQR 269:272) binding in other chain
O42938 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 88% coverage: 4:321/360 of query aligns to 195:534/942 of O42938
Sites not aligning to the query:
- 43 modified: Phosphoserine
- 45 modified: Phosphoserine
- 85 modified: Phosphoserine
- 160 modified: Phosphoserine
- 163 modified: Phosphoserine
- 167 modified: Phosphoserine
- 171 modified: Phosphoserine
- 175 modified: Phosphothreonine
- 600 modified: Phosphoserine
- 602 modified: Phosphothreonine
Q01813 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see paper)
35% identity, 80% coverage: 4:292/360 of query aligns to 25:330/784 of Q01813
Sites not aligning to the query:
- 386 modified: Phosphoserine; S→A: Decreased interaction with ATG4B.
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
34% identity, 89% coverage: 4:322/360 of query aligns to 11:348/761 of 4xyjF
- active site: G20 (= G13), R83 (≠ N80), C84 (≠ R81), D114 (= D109), G158 (≠ K131), S159 (≠ T132), D161 (= D134), D163 (= D136), R205 (= R178)
- binding adenosine-5'-triphosphate: G20 (= G13), Y50 (≠ T44), R83 (≠ N80), C84 (≠ R81), F87 (≠ T84), R88 (≠ L85), G113 (= G108), D114 (= D109), G115 (= G110), S116 (= S111), G119 (vs. gap), S159 (≠ T132)
- binding magnesium ion: G19 (= G12), G20 (= G13), G112 (= G107), D114 (= D109), G158 (≠ K131), D163 (= D136), R205 (= R178)
- binding phosphate ion: R30 (= R23), R34 (= R27), S69 (≠ D66), S70 (≠ P67), G219 (= G192), K250 (≠ R221)
Sites not aligning to the query:
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
34% identity, 89% coverage: 4:322/360 of query aligns to 9:346/737 of 4xykA
- active site: G18 (= G13), R81 (≠ N80), C82 (≠ R81), D112 (= D109), G156 (≠ K131), S157 (≠ T132), D159 (= D134), D161 (= D136), R203 (= R178)
- binding adenosine-5'-diphosphate: Y48 (≠ T44), R81 (≠ N80), C82 (≠ R81), R86 (≠ L85), G111 (= G108), D112 (= D109), G113 (= G110), S114 (= S111)
- binding phosphate ion: R28 (= R23), R32 (= R27), S67 (≠ D66), K248 (≠ R221)
Sites not aligning to the query:
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
34% identity, 89% coverage: 4:322/360 of query aligns to 13:350/768 of 4xyjA
- active site: G22 (= G13), R85 (≠ N80), C86 (≠ R81), D116 (= D109), G160 (≠ K131), S161 (≠ T132), D163 (= D134), D165 (= D136), R207 (= R178)
- binding adenosine-5'-triphosphate: G21 (= G12), G22 (= G13), Y52 (≠ T44), C86 (≠ R81), F89 (≠ T84), R90 (≠ L85), G115 (= G108), D116 (= D109), G117 (= G110), S118 (= S111), G121 (vs. gap), S161 (≠ T132), R207 (= R178)
- binding magnesium ion: G21 (= G12), G22 (= G13), D116 (= D109), D165 (= D136)
- binding phosphate ion: R32 (= R23), R36 (= R27), S72 (≠ P67), G221 (= G192), K252 (≠ R221)
Sites not aligning to the query:
4rh3A Amppcp-bound structure of human platelet phosphofructokinase in an r- state, crystal form ii (see paper)
35% identity, 80% coverage: 6:292/360 of query aligns to 3:306/731 of 4rh3A
- active site: G10 (= G13), R73 (≠ N80), C74 (≠ R81), D104 (= D109), G148 (≠ K131), S149 (≠ T132), D151 (= D134), D153 (= D136), R195 (= R178)
- binding phosphomethylphosphonic acid adenylate ester: G9 (= G12), R73 (≠ N80), C74 (≠ R81), F77 (≠ T84), R78 (≠ L85), G103 (= G108), D104 (= D109), G105 (= G110), S106 (= S111), G109 (vs. gap)
- binding phosphate ion: K240 (≠ R221)
Sites not aligning to the query:
P08237 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 6 papers)
33% identity, 89% coverage: 4:322/360 of query aligns to 16:353/780 of P08237
- R39 (= R27) to P: in GSD7; Italian; dbSNP:rs121918193
- G57 (= G46) to V: in GSD7; Italian
- R100 (≠ L92) to Q: in dbSNP:rs2228500
- S180 (≠ T148) to C: in GSD7; Italian
- G209 (= G177) to D: in GSD7; loss of activity shown by complementation assays in yeast; dbSNP:rs767265360
- D309 (= D280) to G: in GSD7; Spanish; complete loss of enzyme activity; dbSNP:rs1169383137
Sites not aligning to the query:
- 543 D → A: in GSD7; Italian; dbSNP:rs121918194
- 557 modified: N6-(2-hydroxyisobutyryl)lysine
- 591 D → A: in GSD7; Italian
- 686 W → C: in GSD7; Japanese; dbSNP:rs121918196
- 696 R → H: in dbSNP:rs41291971
Query Sequence
>Synpcc7942_0592 FitnessBrowser__SynE:Synpcc7942_0592
MAVRKLGVLTSGGDCPGLNAVIRAIARHAVGNYGWELWGIAYATQGLLKRQAIALSPHHF
DRQSLDPLLCSGGTILGSINRGDTLAHQAEILAGYQELGLDALIGIGGDGSLAILRQLAE
AGRWQFIGIPKTIDNDVALTERAIGFDTAIHTVAEALLSLGSTAASHDRIMIAEVMGRQS
GHLALQGGIAGGADVILLPEIPYRLLELCHYLQQLRDRWQRRYAVIAIAEGTHHPPEVTQ
GPGSLGEQLVQAITAQDPTLDARVTVLGHVQRGGNPVASDRLLATQMGYAAVERLAAGAS
GEMMAWQGGRVVSVPLEAVCLQSPTLVDPHSPLVDTAAGLGIFLGDRSLTPWRGSACPTH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory