Comparing Synpcc7942_0612 FitnessBrowser__SynE:Synpcc7942_0612 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8bp7E Citrate-bound hexamer of synechococcus elongatus citrate synthase (see paper)
100% identity, 98% coverage: 3:381/386 of query aligns to 1:379/379 of 8bp7E
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
44% identity, 96% coverage: 10:379/386 of query aligns to 4:374/374 of 1iomA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
44% identity, 96% coverage: 10:379/386 of query aligns to 4:371/371 of 1ixeA
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
44% identity, 96% coverage: 10:379/386 of query aligns to 6:371/372 of P39120
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
42% identity, 97% coverage: 6:379/386 of query aligns to 2:370/372 of 6abyA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
42% identity, 97% coverage: 6:379/386 of query aligns to 2:370/370 of 6abxA
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
42% identity, 96% coverage: 10:379/386 of query aligns to 4:370/371 of 1aj8A
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
40% identity, 98% coverage: 3:379/386 of query aligns to 36:426/426 of 2h12B
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
39% identity, 96% coverage: 3:373/386 of query aligns to 38:420/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
39% identity, 96% coverage: 3:373/386 of query aligns to 38:420/426 of 4jaeA
1owbA Three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. Coli (see paper)
39% identity, 96% coverage: 3:373/386 of query aligns to 38:420/426 of 1owbA
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 96% coverage: 3:373/386 of query aligns to 39:421/427 of P0ABH7
1nxgA The f383a variant of type ii citrate synthase complexed with nadh (see paper)
38% identity, 96% coverage: 3:373/386 of query aligns to 38:420/426 of 1nxgA
3msuA Crystal structure of citrate synthase from francisella tularensis
36% identity, 95% coverage: 7:373/386 of query aligns to 50:415/415 of 3msuA
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 98% coverage: 2:379/386 of query aligns to 40:431/431 of P9WPD5
3msuB Crystal structure of citrate synthase from francisella tularensis
36% identity, 95% coverage: 7:373/386 of query aligns to 50:426/426 of 3msuB
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
36% identity, 96% coverage: 10:379/386 of query aligns to 1:365/365 of 6s87D
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
36% identity, 93% coverage: 10:367/386 of query aligns to 9:372/379 of O34002
Sites not aligning to the query:
1a59A Cold-active citrate synthase (see paper)
36% identity, 93% coverage: 10:367/386 of query aligns to 7:370/377 of 1a59A
2c6xA Structure of bacillus subtilis citrate synthase
37% identity, 93% coverage: 10:368/386 of query aligns to 4:358/363 of 2c6xA
>Synpcc7942_0612 FitnessBrowser__SynE:Synpcc7942_0612
MTAVSEFRPGLEGVPATLSSISFVDGQRGVLEYRGISIEQLAQQSSFLETAYLLIWGHLP
TQQELTEFEHEIRYHRRIKFRIRDMMKCFPDSGHPMDALQASAAALGLFYSRRALDDPEY
IRAAVVRLLAKIPTMVAAFQLIRKGNDPIQPRDELDYAANFLYMLTEREPDPVAARIFDI
CLTLHAEHTINASTFSAMVTASTLTDPYAVVASAVGTLAGPLHGGANEEVLDMLEAIGSV
ENVEPYLDHCIATKTRIMGFGHRVYKVKDPRAVILQNLAEQLFDIFGHDPYYEIAVAVEK
AAAERLSHKGIYPNVDFYSGLVYRKLGIPSDLFTPVFAIARVAGWLAHWKEQLNENRIFR
PTQIYTGSHNLDYTPIADRDLAIESD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory