SitesBLAST
Comparing Synpcc7942_0623 FitnessBrowser__SynE:Synpcc7942_0623 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
61% identity, 98% coverage: 3:453/459 of query aligns to 68:514/515 of Q70G58
- C203 (= C138) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C141) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A162) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (= V180) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R181) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
- C440 (= C379) mutation to S: Loss of thioredoxin activity.
- C443 (= C382) mutation to S: Loss of thioredoxin activity.
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
67% identity, 69% coverage: 4:322/459 of query aligns to 1:316/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G11), S9 (= S12), G10 (= G13), P11 (= P14), A12 (= A15), E31 (= E34), G32 (= G35), N35 (≠ L38), G36 (= G39), G39 (= G44), Q40 (= Q45), L41 (= L46), T44 (= T49), N49 (= N54), D81 (= D86), V82 (= V87), A109 (= A114), T110 (= T115), W126 (= W131), S136 (≠ C141), G276 (= G282), D277 (= D283), R284 (= R290), Q285 (= Q291), A286 (= A292), A289 (= A295)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
58% identity, 66% coverage: 7:311/459 of query aligns to 5:320/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (= I10), G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), Y31 (≠ F33), E32 (= E34), G33 (= G35), A36 (≠ L38), T38 (≠ G40), A39 (≠ L41), G42 (= G44), Q43 (= Q45), L44 (= L46), T47 (= T49), I50 (≠ V52), N52 (= N54), T84 (≠ D86), I85 (≠ V87), T120 (= T115), G121 (= G116), C146 (= C141), G291 (= G282), D292 (= D283), R299 (= R290), Q300 (= Q291), A301 (= A292), S304 (≠ A295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G158), G164 (= G159), S166 (≠ T161), R186 (= R181), R187 (≠ S182), R191 (= R186), V252 (≠ I243)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
58% identity, 67% coverage: 6:311/459 of query aligns to 19:331/356 of 5w4cA
- binding calcium ion: E99 (= E85), E116 (≠ Q102), E118 (≠ R104)
- binding flavin-adenine dinucleotide: I23 (= I10), G24 (= G11), S25 (= S12), P27 (= P14), G28 (≠ A15), Y46 (≠ F33), G48 (= G35), A51 (≠ L38), F54 (≠ L41), G58 (= G44), Q59 (= Q45), L60 (= L46), T63 (= T49), N68 (= N54), V101 (= V87), T134 (= T115), G135 (= G116), G302 (= G282), D303 (= D283), R310 (= R290), Q311 (= Q291), A312 (= A292), S315 (≠ A295)
Sites not aligning to the query:
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
55% identity, 67% coverage: 7:312/459 of query aligns to 5:316/318 of 3d8xA
- active site: C141 (= C138), C144 (= C141), D145 (= D142)
- binding flavin-adenine dinucleotide: I8 (= I10), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), Y31 (≠ F33), G33 (= G35), A36 (≠ L38), I39 (≠ L41), G43 (= G44), Q44 (= Q45), I51 (≠ V52), N53 (= N54), T85 (≠ D86), V86 (= V87), T118 (= T115), G119 (= G116), C144 (= C141), G286 (= G282), D287 (= D283), R294 (= R290), Q295 (= Q291), A296 (= A292), S299 (≠ A295)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L122), G160 (= G157), S164 (≠ T161), R184 (= R181), K185 (≠ S182), R189 (= R186), I247 (= I243)
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
55% identity, 67% coverage: 7:312/459 of query aligns to 6:317/319 of P29509
- SGPA 11:14 (= SGPA 12:15) binding
- IA 40:41 (≠ LP 41:42) binding
- Q45 (= Q45) binding
- N54 (= N54) binding
- V87 (= V87) binding
- C142 (= C138) modified: Disulfide link with 145, Redox-active
- C145 (= C141) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D283) binding
- RQA 295:297 (= RQA 290:292) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
55% identity, 67% coverage: 7:312/459 of query aligns to 6:317/319 of 3itjB
- active site: C142 (= C138), C145 (= C141), D146 (= D142)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), S11 (= S12), G12 (= G13), P13 (= P14), A14 (= A15), Y32 (≠ F33), E33 (= E34), G34 (= G35), A37 (≠ L38), I40 (≠ L41), A41 (≠ P42), G44 (= G44), Q45 (= Q45), T49 (= T49), I52 (≠ V52), N54 (= N54), T86 (≠ D86), V87 (= V87), T119 (= T115), G120 (= G116), W135 (= W131), C145 (= C141), G287 (= G282), D288 (= D283), R295 (= R290), Q296 (= Q291), A297 (= A292), S300 (≠ A295)
4ccqA Crystal structure of the thioredoxin reductase from entamoeba histolytica with NADP (see paper)
54% identity, 68% coverage: 2:313/459 of query aligns to 1:313/313 of 4ccqA
- active site: C139 (= C138), C142 (= C141), D143 (= D142), D161 (= D160), E165 (= E164)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), S11 (= S12), G12 (= G13), P13 (= P14), A14 (= A15), Y32 (≠ F33), E33 (= E34), G34 (= G35), A37 (≠ L38), V40 (≠ L41), A41 (≠ P42), G44 (= G44), Q45 (= Q45), L46 (= L46), T49 (= T49), N54 (= N54), T86 (≠ D86), I87 (≠ V87), T116 (= T115), G117 (= G116), H247 (= H245), G282 (= G282), D283 (= D283), R290 (= R290), Q291 (= Q291), A292 (= A292), A295 (= A295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G159 (= G158), G160 (= G159), D161 (= D160), A162 (≠ T161), E165 (= E164), H181 (≠ V180), R182 (= R181), R183 (≠ S182), R187 (= R186), I245 (= I243)
4a5lA Crystal structure of the thioredoxin reductase from entamoeba histolytica (see paper)
54% identity, 68% coverage: 2:313/459 of query aligns to 1:313/313 of 4a5lA
- active site: C139 (= C138), C142 (= C141), D143 (= D142), D161 (= D160), E165 (= E164)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), S11 (= S12), G12 (= G13), P13 (= P14), A14 (= A15), Y32 (≠ F33), E33 (= E34), G34 (= G35), A37 (≠ L38), V40 (≠ L41), A41 (≠ P42), G44 (= G44), Q45 (= Q45), L46 (= L46), T49 (= T49), I52 (≠ V52), N54 (= N54), T86 (≠ D86), I87 (≠ V87), T116 (= T115), G117 (= G116), H247 (= H245), G282 (= G282), D283 (= D283), R290 (= R290), Q291 (= Q291), A292 (= A292), A295 (= A295)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G159 (= G158), A162 (≠ T161), H181 (≠ V180), R182 (= R181), R183 (≠ S182), R187 (= R186), I245 (= I243)
4a65A Crystal structure of the thioredoxin reductase from entamoeba histolytica with aucn (see paper)
55% identity, 68% coverage: 4:313/459 of query aligns to 1:311/311 of 4a65A
- active site: C137 (= C138), C140 (= C141), D141 (= D142), D159 (= D160), E163 (= E164)
- binding gold ion: G280 (= G282), C283 (≠ Q285)
- binding flavin-adenine dinucleotide: I7 (= I10), G8 (= G11), S9 (= S12), G10 (= G13), P11 (= P14), A12 (= A15), Y30 (≠ F33), E31 (= E34), G32 (= G35), A35 (≠ L38), V38 (≠ L41), A39 (≠ P42), G42 (= G44), Q43 (= Q45), N52 (= N54), T84 (≠ D86), I85 (≠ V87), T114 (= T115), G115 (= G116), H245 (= H245), G280 (= G282), D281 (= D283), R288 (= R290), Q289 (= Q291), A290 (= A292), A293 (= A295)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G157 (= G158), G158 (= G159), A160 (≠ T161), H179 (≠ V180), R180 (= R181), R181 (≠ S182), R185 (= R186), I243 (= I243)
Q92375 Thioredoxin reductase; Caffeine resistance protein 4; EC 1.8.1.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
58% identity, 66% coverage: 7:310/459 of query aligns to 6:315/322 of Q92375
- S192 (= S188) modified: Phosphoserine
- T278 (= T273) modified: Phosphothreonine
- S279 (= S274) modified: Phosphoserine
Q39243 Thioredoxin reductase 1, mitochondrial; NADPH-dependent thioredoxin reductase 1; NTR1; NADPH-dependent thioredoxin reductase B; AtNTRB; EC 1.8.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
54% identity, 68% coverage: 1:310/459 of query aligns to 43:364/375 of Q39243
- SGPA 58:61 (= SGPA 12:15) binding
- FE 79:80 (= FE 33:34) binding
- IAPGGQ 87:92 (≠ L-PGGQ 41:45) binding
- N101 (= N54) binding
- V134 (= V87) binding
- C189 (= C138) modified: Disulfide link with 192, Redox-active
- C192 (= C141) binding ; modified: Disulfide link with 189, Redox-active
- D337 (= D283) binding
- RQA 344:346 (= RQA 290:292) binding
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
2whdB Barley NADPH-dependent thioredoxin reductase 2 (see paper)
57% identity, 66% coverage: 7:310/459 of query aligns to 9:316/319 of 2whdB
- active site: C141 (= C138), C144 (= C141), D145 (= D142)
- binding flavin-adenine dinucleotide: G13 (= G11), S14 (= S12), G15 (= G13), P16 (= P14), A17 (= A15), G37 (= G35), A40 (≠ L38), G47 (= G44), Q48 (= Q45), L49 (= L46), T52 (= T49), N57 (= N54), T89 (≠ D86), V90 (= V87), T118 (= T115), G119 (= G116), C144 (= C141), G288 (= G282), D289 (= D283), R296 (= R290), Q297 (= Q291), A298 (= A292)
1vdcA Structure of NADPH dependent thioredoxin reductase (see paper)
55% identity, 66% coverage: 7:310/459 of query aligns to 8:319/322 of 1vdcA
- active site: C144 (= C138), C147 (= C141), D148 (= D142)
- binding flavin-adenine dinucleotide: G12 (= G11), S13 (= S12), G14 (= G13), P15 (= P14), A16 (= A15), F34 (= F33), E35 (= E34), G36 (= G35), A39 (≠ L38), I42 (≠ L41), G46 (= G44), Q47 (= Q45), L48 (= L46), V54 (= V52), N56 (= N54), T88 (≠ D86), V89 (= V87), I117 (≠ T115), G118 (= G116), C147 (= C141), G291 (= G282), D292 (= D283), R299 (= R290), Q300 (= Q291), A301 (= A292), A304 (= A295)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
53% identity, 67% coverage: 4:311/459 of query aligns to 3:304/306 of 5uthA
- active site: C133 (= C138), C136 (= C141), D137 (= D142)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), S11 (= S12), G12 (= G13), P13 (= P14), A14 (= A15), F32 (= F33), E33 (= E34), G34 (= G35), Q36 (= Q37), G39 (= G40), A40 (≠ Q45), L41 (= L46), N49 (= N54), D81 (= D86), V82 (= V87), M110 (≠ T115), G111 (= G116), C136 (= C141), G275 (= G282), D276 (= D283), R283 (= R290), Q284 (= Q291), A285 (= A292), A288 (= A295)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
53% identity, 67% coverage: 4:311/459 of query aligns to 2:303/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (= I10), G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), E32 (= E34), G33 (= G35), Q35 (= Q37), G38 (= G40), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (= D86), V81 (= V87), M109 (≠ T115), G110 (= G116), T131 (≠ A137), C135 (= C141), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (= A295)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R120), H115 (≠ R121), L116 (= L122), R173 (= R181), E200 (= E208), I201 (≠ A209), I235 (= I243)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
53% identity, 67% coverage: 4:311/459 of query aligns to 2:303/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (= I10), G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), E32 (= E34), G33 (= G35), Q35 (= Q37), G38 (= G40), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (= D86), V81 (= V87), M109 (≠ T115), G110 (= G116), T131 (≠ A137), C135 (= C141), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (= A295)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L122), R173 (= R181), E200 (= E208), I201 (≠ A209)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
53% identity, 67% coverage: 4:311/459 of query aligns to 2:303/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), E32 (= E34), G33 (= G35), Q35 (= Q37), G38 (= G40), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (= D86), V81 (= V87), M109 (≠ T115), G110 (= G116), T131 (≠ A137), C135 (= C141), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (= A295)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R120), H115 (≠ R121), L116 (= L122), V148 (≠ I156), R173 (= R181), E200 (= E208), I201 (≠ A209)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
53% identity, 67% coverage: 4:311/459 of query aligns to 2:303/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (= I10), G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), E32 (= E34), G33 (= G35), Q35 (= Q37), G38 (= G40), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (= D86), V81 (= V87), M109 (≠ T115), G110 (= G116), T131 (≠ A137), C135 (= C141), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (= A295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G158), G151 (= G159), D152 (= D160), S153 (≠ T161), E156 (= E164), H172 (≠ V180), R173 (= R181), R174 (≠ S182), R178 (= R186), I235 (= I243)
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
49% identity, 68% coverage: 4:313/459 of query aligns to 5:309/313 of 2a87A
- active site: F39 (≠ L38), L43 (= L46), D48 (≠ E51), C136 (= C138), C139 (= C141), D140 (= D142)
- binding flavin-adenine dinucleotide: G12 (= G11), S13 (= S12), G14 (= G13), P15 (= P14), A16 (= A15), F34 (= F33), E35 (= E34), G36 (= G35), G40 (= G39), G41 (= G40), A42 (≠ Q45), L43 (= L46), T46 (= T49), V49 (= V52), N51 (= N54), D83 (= D86), V84 (= V87), M113 (≠ T115), C139 (= C141), G278 (= G282), D279 (= D283), R286 (= R290), Q287 (= Q291), A288 (= A292), V289 (≠ I293)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L122), G155 (= G159), D156 (= D160), S157 (≠ T161), H176 (≠ V180), R177 (= R181), R178 (≠ S182), R182 (= R186), I239 (= I243), Y259 (= Y263), R283 (≠ H287), R286 (= R290)
Query Sequence
>Synpcc7942_0623 FitnessBrowser__SynE:Synpcc7942_0623
MTGVENVVIIGSGPAGLTAAIYAARANLKPLMFEGYQLGGLPGGQLMTTTEVENFPGFPE
GITGPELMERMRAQAVRWGAELYTEDVISADLSQRPFRIRSQEREVLAHSVIIATGATAR
RLSLPGEDRLWNNGISACAICDGAAPIFRDGELVVIGGGDTAAEEAVYLTKYAKHVHLLV
RSDRMRASKAMQDRVLAHPNVTVHWHTEAIEAVGNTLLEAVRVRNNQTGEEKAIAAQGLF
YAIGHTPNTKLFEGQIELDGTGYIRTKPDSVETSLEGVFAAGDVQDHEYRQAITAAGTGC
AAALLAERYLSAHNLLQEYKQEAAAAEPETKAAATPAASQPEASEFDPTSVYHEGSYALR
KLYHESDRLLAVLYTAPTCGPCRTLKPILRKVAEEFSDRLHYVLIDIDADPEIAQSAGVV
GTPTLQLFKDKAKVDEIRGVKMKSDYRARFEQHLQPVSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory