Comparing Synpcc7942_0638 FitnessBrowser__SynE:Synpcc7942_0638 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
63% identity, 93% coverage: 1:128/137 of query aligns to 1:128/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
63% identity, 93% coverage: 1:128/137 of query aligns to 1:128/128 of 1fa5A
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
62% identity, 95% coverage: 1:130/137 of query aligns to 1:130/135 of P0AC81
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
61% identity, 93% coverage: 1:128/137 of query aligns to 1:128/128 of 4mttA
6bnnA Crystal structure of v278e-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 (see paper)
54% identity, 91% coverage: 2:125/137 of query aligns to 16:139/282 of 6bnnA
Sites not aligning to the query:
5d7zA Crystal structure of glyoxalase i from zea mays (see paper)
54% identity, 91% coverage: 2:125/137 of query aligns to 10:133/281 of 5d7zA
Sites not aligning to the query:
Q948T6 Lactoylglutathione lyase; Aldoketomutase; Allergen Glb33; Glyoxalase I; Glx I; Glyoxylase I 11; OsGLYI-11; OsGLYI11; Ketone-aldehyde mutase; Methylglyoxalase; PP33; S-D-lactoylglutathione methylglyoxal lyase; Allergen Ory s Glyoxalase I; EC 4.4.1.5 from Oryza sativa subsp. japonica (Rice) (see paper)
52% identity, 93% coverage: 2:129/137 of query aligns to 24:152/291 of Q948T6
Sites not aligning to the query:
2c21A Specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme (see paper)
49% identity, 97% coverage: 2:134/137 of query aligns to 3:130/139 of 2c21A
P50107 Glyoxalase I; Glx I; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; actoylglutathione lyase; EC 4.4.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
41% identity, 92% coverage: 2:127/137 of query aligns to 182:323/326 of P50107
Sites not aligning to the query:
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
36% identity, 90% coverage: 3:125/137 of query aligns to 32:176/184 of Q9CPU0
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
36% identity, 90% coverage: 3:125/137 of query aligns to 25:169/177 of 6l0uB
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
36% identity, 90% coverage: 3:125/137 of query aligns to 25:169/177 of 4kykB
2za0A Crystal structure of mouse glyoxalase i complexed with methyl-gerfelin (see paper)
36% identity, 90% coverage: 3:125/137 of query aligns to 29:173/180 of 2za0A
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
36% identity, 90% coverage: 3:125/137 of query aligns to 27:171/177 of 4kyhA
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
36% identity, 90% coverage: 3:125/137 of query aligns to 27:171/179 of 4kykA
4x2aA Crystal structure of mouse glyoxalase i complexed with baicalein (see paper)
36% identity, 90% coverage: 3:125/137 of query aligns to 18:162/167 of 4x2aA
Sites not aligning to the query:
4pv5A Crystal structure of mouse glyoxalase i in complexed with 18-beta- glycyrrhetinic acid (see paper)
36% identity, 90% coverage: 3:125/137 of query aligns to 20:164/170 of 4pv5A
4opnA Crystal structure of mouse glyoxalase i complexed with mah
36% identity, 90% coverage: 3:125/137 of query aligns to 24:168/172 of 4opnA
Sites not aligning to the query:
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
36% identity, 91% coverage: 3:127/137 of query aligns to 32:178/184 of Q04760
Sites not aligning to the query:
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
36% identity, 91% coverage: 3:127/137 of query aligns to 31:177/185 of 7wt0A
Sites not aligning to the query:
>Synpcc7942_0638 FitnessBrowser__SynE:Synpcc7942_0638
MRLLHTMLRVGDLERSLQFYCEILGMQLLRRKDYPGGEFTLAFVGYGEEADHTVLELTYN
WGKEQYELGDAYGHIAIGVDDIYATCEAIRARGGKISREPGPMKHGSTVIAFVEDPDGYK
VELIQTGTSGASAQPAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory