Comparing Synpcc7942_0660 FitnessBrowser__SynE:Synpcc7942_0660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
51% identity, 86% coverage: 46:323/323 of query aligns to 1:278/279 of 2f1kA
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
32% identity, 86% coverage: 42:319/323 of query aligns to 1:283/293 of 4wjiA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
29% identity, 82% coverage: 50:314/323 of query aligns to 18:285/293 of 3gggD
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
29% identity, 82% coverage: 50:314/323 of query aligns to 10:277/285 of 3ggoA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
29% identity, 82% coverage: 50:314/323 of query aligns to 10:277/286 of 3ggpA
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
33% identity, 85% coverage: 48:321/323 of query aligns to 9:284/286 of 3b1fA
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
29% identity, 85% coverage: 47:319/323 of query aligns to 3:279/365 of 6u60B
Sites not aligning to the query:
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
29% identity, 85% coverage: 47:319/323 of query aligns to 11:287/373 of 5uyyA
Sites not aligning to the query:
>Synpcc7942_0660 FitnessBrowser__SynE:Synpcc7942_0660
MMRPGIFCSLLSQPAAQQLVNFDLKHWLILAASGSVGSTTVARDVMRIGIVGLGLIGGSL
GFDWRDRGHRLLGYSRRPATCERAIARGVVDHASPDPAVLTEAEVIVLATPLGVLETTVR
ELRDYWHPEAIVTDVGSVKQPIVAALDPLWPRFVGGHPMAGTAENGIEAALRGLFQNRPY
VLTPTDQTDPAAIAVVAQLAQELGSVVLHCDPASHDRAVATISHLPVFISASLIQTCLQE
PDPAVQTLAATLASSGFCDTSRVGGGNPELGVMMARYNQAALLEQIDRYQIQLERLKTAI
AAADEPAIAAILQQNQEMRPRYL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory