SitesBLAST
Comparing Synpcc7942_0684 Synpcc7942_0684 3-oxoacyl-[acyl-carrier-protein] reductase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
98% identity, 99% coverage: 4:249/249 of query aligns to 1:240/240 of 4dmmB
- active site: G16 (= G19), S142 (= S145), Q152 (= Q155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (= S17), R15 (= R18), G16 (= G19), I17 (= I20), A37 (= A40), S38 (= S41), S39 (= S42), A62 (= A65), D63 (= D66), V64 (= V67), N90 (= N93), A91 (= A94), L113 (= L116), I140 (= I143), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), G186 (= G189), I188 (= I191), T190 (= T193), M192 (= M195)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
71% identity, 100% coverage: 1:248/249 of query aligns to 1:246/247 of P73574
- A14 (= A16) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P153) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K162) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F190) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ A200) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
63% identity, 95% coverage: 10:246/249 of query aligns to 3:242/244 of 1edoA
- active site: G12 (= G19), S138 (= S145), Y151 (= Y158), K155 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), S10 (= S17), R11 (= R18), I13 (= I20), N31 (= N38), Y32 (= Y39), A33 (= A40), R34 (≠ S41), S35 (= S42), D59 (= D66), V60 (= V67), N86 (= N93), A87 (= A94), S138 (= S145), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189), I184 (= I191), S186 (≠ T193), M188 (= M195)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
60% identity, 96% coverage: 9:248/249 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G19), S138 (= S145), Q148 (= Q155), Y151 (= Y158), K155 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), S10 (= S17), R11 (= R18), I13 (= I20), N31 (= N38), Y32 (= Y39), A33 (= A40), G34 (≠ S41), S35 (= S42), A58 (= A65), N59 (≠ D66), V60 (= V67), N86 (= N93), A87 (= A94), T109 (≠ L116), S138 (= S145), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
59% identity, 96% coverage: 9:248/249 of query aligns to 5:246/246 of 3osuA
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
57% identity, 98% coverage: 4:248/249 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G19), S142 (= S145), Q152 (= Q155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (= S17), R15 (= R18), G16 (= G19), I17 (= I20), N35 (= N38), Y36 (= Y39), N37 (≠ A40), G38 (≠ S41), S39 (= S42), N63 (≠ D66), V64 (= V67), N90 (= N93), A91 (= A94), I93 (= I96), I113 (≠ L116), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), I188 (= I191), T190 (= T193)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
50% identity, 98% coverage: 4:248/249 of query aligns to 4:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G15), S17 (= S17), R18 (= R18), I20 (= I20), T40 (≠ A40), N62 (≠ D66), V63 (= V67), N89 (= N93), A90 (= A94), I92 (= I96), V139 (≠ I143), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), I187 (= I191), T189 (= T193), M191 (= M195)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
51% identity, 98% coverage: 4:248/249 of query aligns to 4:242/243 of 4i08A
- active site: G19 (= G19), N113 (= N117), S141 (= S145), Q151 (= Q155), Y154 (= Y158), K158 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G15), S17 (= S17), R18 (= R18), I20 (= I20), T40 (≠ A40), N62 (≠ D66), V63 (= V67), N89 (= N93), A90 (= A94), G140 (≠ A144), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), T189 (= T193)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
50% identity, 98% coverage: 4:248/249 of query aligns to 1:243/244 of 6t77A
- active site: G16 (= G19), S138 (= S145), Y151 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (= S17), R15 (= R18), T37 (≠ A40), L58 (≠ V63), N59 (≠ D66), V60 (= V67), A87 (= A94), G88 (= G95), I89 (= I96)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
51% identity, 96% coverage: 9:248/249 of query aligns to 5:242/243 of 7emgB
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
50% identity, 98% coverage: 4:248/249 of query aligns to 1:243/244 of P0AEK2
- GASR 12:15 (= GASR 15:18) binding
- T37 (≠ A40) binding
- NV 59:60 (≠ DV 66:67) binding
- N86 (= N93) binding
- Y151 (= Y158) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSAAK 158:162) binding
- A154 (= A161) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K162) mutation to A: Defect in the affinity for NADPH.
- I184 (= I191) binding
- E233 (≠ Q238) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
51% identity, 96% coverage: 9:248/249 of query aligns to 5:242/243 of 1q7bA
- active site: G15 (= G19), E101 (≠ D109), S137 (= S145), Q147 (= Q155), Y150 (= Y158), K154 (= K162)
- binding calcium ion: E232 (≠ Q238), T233 (≠ V239)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G15), S13 (= S17), R14 (= R18), T36 (≠ A40), N58 (≠ D66), V59 (= V67), N85 (= N93), A86 (= A94), G87 (= G95), I88 (= I96), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), I183 (= I191)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
50% identity, 98% coverage: 4:248/249 of query aligns to 1:243/244 of P0A2C9
- M125 (= M132) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A227) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (≠ A228) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
51% identity, 96% coverage: 9:248/249 of query aligns to 5:242/243 of 1q7cA
- active site: G15 (= G19), S137 (= S145), Q147 (= Q155), F150 (≠ Y158), K154 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G15), S13 (= S17), R14 (= R18), A35 (≠ Y39), T36 (≠ A40), L57 (≠ V63), N58 (≠ D66), V59 (= V67), G87 (= G95), I88 (= I96)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
51% identity, 100% coverage: 1:249/249 of query aligns to 5:254/254 of 4ag3A
- active site: G23 (= G19), S148 (= S145), Y161 (= Y158), K165 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G15), S21 (= S17), R22 (= R18), G23 (= G19), I24 (= I20), T44 (≠ S41), L68 (≠ A65), D69 (= D66), V70 (= V67), N96 (= N93), A97 (= A94), I146 (= I143), S148 (= S145), Y161 (= Y158), K165 (= K162), P191 (= P188), G192 (= G189), F193 (= F190), I194 (= I191), T196 (= T193), M198 (= M195), T199 (= T196)
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
51% identity, 100% coverage: 1:249/249 of query aligns to 11:255/255 of 4bo4C
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
48% identity, 97% coverage: 9:249/249 of query aligns to 6:244/244 of 6wprA
- active site: G16 (= G19), S138 (= S145), Y151 (= Y158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (= S17), R15 (= R18), T37 (≠ S41), L58 (≠ A65), D59 (= D66), V60 (= V67), N86 (= N93), A87 (= A94), G88 (= G95), I89 (= I96), I136 (= I143), Y151 (= Y158), K155 (= K162), P181 (= P188)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
48% identity, 97% coverage: 9:249/249 of query aligns to 6:244/244 of 6t62A
- active site: G16 (= G19), S138 (= S145), Y151 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (= S17), R15 (= R18), A36 (= A40), T37 (≠ S41), L58 (≠ A65), D59 (= D66), V60 (= V67), N86 (= N93), A87 (= A94), G88 (= G95), I89 (= I96), I136 (= I143), S137 (≠ A144), S138 (= S145), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189), I184 (= I191), M188 (= M195)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
47% identity, 99% coverage: 2:248/249 of query aligns to 2:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G15), R18 (= R18), G19 (= G19), I20 (= I20), D39 (≠ Y39), R40 (≠ A40), C63 (≠ A65), I65 (≠ V67), N91 (= N93), G93 (= G95), I94 (= I96), V114 (≠ L116), Y155 (= Y158), K159 (= K162), I188 (= I191), T190 (= T193), T193 (= T196)
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
49% identity, 99% coverage: 3:249/249 of query aligns to 2:241/241 of 4bnzA
Query Sequence
>Synpcc7942_0684 Synpcc7942_0684 3-oxoacyl-[acyl-carrier-protein] reductase
MTALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEA
FAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGG
VFLCSRAAAKIMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRG
ITVNAVAPGFIATDMTSELAAEKLLEVIPLGRYGEAAEVAGVVRFLAADPAAAYITGQVI
NIDGGLVMA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory