Comparing Synpcc7942_0707 FitnessBrowser__SynE:Synpcc7942_0707 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x3lB Crystal structure of the orn_lys_arg decarboxylase family protein sar0482 from methicillin-resistant staphylococcus aureus (see paper)
28% identity, 96% coverage: 4:471/489 of query aligns to 1:421/423 of 2x3lB
6q6iA Lysine decarboxylase a from pseudomonas aeruginosa
30% identity, 60% coverage: 4:298/489 of query aligns to 149:471/749 of 6q6iA
2vycA Crystal structure of acid induced arginine decarboxylase from e. Coli (see paper)
28% identity, 60% coverage: 4:298/489 of query aligns to 141:464/755 of 2vycA
P28629 Biodegradative arginine decarboxylase; ADC; EC 4.1.1.19 from Escherichia coli (strain K12) (see paper)
28% identity, 60% coverage: 4:298/489 of query aligns to 141:464/755 of P28629
5xx1G Crystal structure of arginine decarboxylase (adia) from salmonella typhimurium (see paper)
29% identity, 60% coverage: 4:298/489 of query aligns to 142:444/735 of 5xx1G
6q7lA Inducible lysine decarboxylase (see paper)
27% identity, 60% coverage: 4:298/489 of query aligns to 131:442/711 of 6q7lA
3n75A X-ray crystal structure of the escherichia coli inducible lysine decarboxylase ldci (see paper)
27% identity, 60% coverage: 4:298/489 of query aligns to 131:442/711 of 3n75A
Sites not aligning to the query:
1ordA Crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution (see paper)
25% identity, 59% coverage: 4:290/489 of query aligns to 109:434/730 of 1ordA
1c4kA Ornithine decarboxylase mutant (gly121tyr) (see paper)
25% identity, 59% coverage: 4:290/489 of query aligns to 107:432/728 of 1c4kA
8snjA Crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form)
34% identity, 25% coverage: 77:197/489 of query aligns to 47:159/370 of 8snjA
8sngA Crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p21 form)
34% identity, 25% coverage: 77:197/489 of query aligns to 47:159/368 of 8sngA
Sites not aligning to the query:
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
26% identity, 52% coverage: 68:321/489 of query aligns to 71:304/398 of 1pg8A
Sites not aligning to the query:
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
26% identity, 52% coverage: 68:321/489 of query aligns to 71:304/398 of P13254
Sites not aligning to the query:
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
26% identity, 52% coverage: 68:321/489 of query aligns to 65:298/392 of 5x2xA
Sites not aligning to the query:
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
26% identity, 52% coverage: 68:321/489 of query aligns to 65:298/392 of 5x2wA
Sites not aligning to the query:
Q8ZNF3 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Polymyxin resistance protein PmrH; UDP-(beta-L-threo-pentapyranosyl-4''-ulose diphosphate) aminotransferase; UDP-Ara4O aminotransferase; UDP-4-amino-4-deoxy-L-arabinose aminotransferase; EC 2.6.1.87 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 51% coverage: 84:330/489 of query aligns to 60:309/385 of Q8ZNF3
1mdzA Crystal structure of arnb aminotransferase with cycloserine and pyridoxal 5' phosphate (see paper)
34% identity, 24% coverage: 84:200/489 of query aligns to 52:167/364 of 1mdzA
Sites not aligning to the query:
1mdxA Crystal structure of arnb transferase with pyridoxal 5' phosphate (see paper)
34% identity, 24% coverage: 84:200/489 of query aligns to 52:167/366 of 1mdxA
Sites not aligning to the query:
1mdoA Crystal structure of arnb aminotransferase with pyridomine 5' phosphate (see paper)
34% identity, 24% coverage: 84:200/489 of query aligns to 52:167/365 of 1mdoA
Sites not aligning to the query:
4ocaA Cryatal structure of arnb k188a complexted with plp and udp-ara4n (see paper)
34% identity, 24% coverage: 84:200/489 of query aligns to 53:168/363 of 4ocaA
Sites not aligning to the query:
>Synpcc7942_0707 FitnessBrowser__SynE:Synpcc7942_0707
MAKPLFDQLLASAQQARAPFHTPGHKLGRAIATHLQQAWGSAIFQSDLPELPELDNLYAA
SGVLAESQAQAAEVFGADRSWFLVNGSTGGLLAAILTICSPGDRLLLPRNAHRSLLSGCI
LSGAMPVWITPPEAADFDLVGVPTPEQVATALAQDPQIKAVVLVSPTYEGVCADVAAIAA
IAHNHNLPLIIDAAHGAHLGFHPDLPRSPLHEGADLVVQSTHKLLGALTQAAMLHCKGDR
IDPERLSQSLALVQSSSPSYLLLASLEAATEQMRTSAQDLLQVTIDLARQAHQRLAELPG
LQLPALKIGNREGFPQWDRTRLVINFQSCGWSGFCADEYLHEQWQVTAELPSLSNLVFHL
SLGNRIEDIDRLVTACDRLLSQEHQEELPPRLPVWLEPETILSPRQAWFSRHQTVSAEQA
IGAIAAECVCPYPPGIPVLLPGERISKSAVDYLRQVQTTGGILSGCADPELTTLRIVQDS
DTIHASCLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory