Comparing Synpcc7942_0815 FitnessBrowser__SynE:Synpcc7942_0815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
45% identity, 92% coverage: 16:238/243 of query aligns to 15:238/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
34% identity, 89% coverage: 22:238/243 of query aligns to 17:235/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
36% identity, 89% coverage: 22:238/243 of query aligns to 17:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
36% identity, 89% coverage: 22:238/243 of query aligns to 17:235/238 of 6s8gA
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
36% identity, 89% coverage: 22:238/243 of query aligns to 17:235/235 of 6mhzA
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
36% identity, 89% coverage: 22:238/243 of query aligns to 18:236/241 of 6mbnA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
36% identity, 89% coverage: 22:237/243 of query aligns to 17:234/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
36% identity, 89% coverage: 22:237/243 of query aligns to 17:234/234 of 4p31A
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
36% identity, 88% coverage: 22:236/243 of query aligns to 17:233/233 of 6b8bA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 93% coverage: 5:230/243 of query aligns to 1:227/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 93% coverage: 6:230/243 of query aligns to 3:229/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 93% coverage: 6:230/243 of query aligns to 3:229/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 93% coverage: 6:230/243 of query aligns to 3:229/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 93% coverage: 6:230/243 of query aligns to 3:229/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 86% coverage: 20:227/243 of query aligns to 14:224/240 of 4ymuJ
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 92% coverage: 16:238/243 of query aligns to 13:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 92% coverage: 16:239/243 of query aligns to 13:254/254 of 1g6hA
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
31% identity, 91% coverage: 7:227/243 of query aligns to 353:575/590 of 7n59A
Sites not aligning to the query:
7n5aA Structure of atatm3 in the closed conformation (see paper)
31% identity, 91% coverage: 7:227/243 of query aligns to 352:574/589 of 7n5aA
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 91% coverage: 7:227/243 of query aligns to 479:701/728 of Q9LVM1
>Synpcc7942_0815 FitnessBrowser__SynE:Synpcc7942_0815
MNAAPLLDLDQVFAGYLPDLDIVQGVNLQVAAGELLTLLGPNGAGKSTLAKTLLGLVPVR
SGSIRFRGQEISRLSSEAIVRLGIGYVPQVRNVFASLTVAENLEMGLFQIRPQHRPAAIA
RIYDLFPTLATRRSQRAGTLSGGERQLLAMGRALAAEPTLLVLDEPSAALSPLMVATVFE
QIRAINNSGTTIILVEQNTRRALQLADRGCILESGRDRQTGPAAELLDDPLLGELYLGRS
QES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory