SitesBLAST
Comparing Synpcc7942_0854 FitnessBrowser__SynE:Synpcc7942_0854 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
8jboA Crystal structure of txgh116 from thermoanaerobacterium xylanolyticum with isofagomine (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 8:767/769 of 8jboA
- binding calcium ion: P370 (≠ S382), D371 (= D383), D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding 5-hydroxymethyl-3,4-dihydroxypiperidine: E409 (= E419), Y413 (= Y423), D420 (= D430), H475 (= H491), W499 (= W515), T559 (= T575), E745 (= E761), R754 (= R770)
5bx4A Crystal structure of thermoanaerobacterium xylanolyticum gh116 beta- glucosidase with glucoimidazole (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 8:767/769 of 5bx4A
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding glucoimidazole: E409 (= E419), Y413 (= Y423), D420 (= D430), H475 (= H491), Y491 (≠ T507), T559 (= T575), E745 (= E761), R754 (= R770)
5bx3A Crystal structure of thermoanaerobacterium xylanolyticum gh116 beta- glucosidase with deoxynojirimycin (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 8:767/769 of 5bx3A
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding 1-deoxynojirimycin: E409 (= E419), D420 (= D430), H475 (= H491), Y491 (≠ T507), T559 (= T575), D561 (= D577), E745 (= E761), R754 (= R770)
5bx2A Crystal structure of thermoanaerobacterium xylanolyticum gh116 beta- glucosidase with 2-deoxy-2-fluoroglucoside (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 8:767/769 of 5bx2A
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: E409 (= E419), Y413 (= Y423), D420 (= D430), H475 (= H491), Y491 (≠ T507), T559 (= T575), E745 (= E761), R754 (= R770)
5o0sA Crystal structure of txgh116 (beta-glucosidase from thermoanaerobacterium xylolyticum) in complex with unreacted beta cyclophellitol cyclosulfate probe me711 (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 8:766/768 of 5o0sA
- binding (3~{a}~{S},4~{R},5~{S},6~{R},7~{R},7~{a}~{R})-7-(hydroxymethyl)-2,2-bis(oxidanylidene)-3~{a},4,5,6,7,7~{a}-hexahydrobenzo[d][1,3,2]dioxathiole-4,5,6-triol: E408 (= E419), Y412 (= Y423), D419 (= D430), H474 (= H491), Y490 (≠ T507), T558 (= T575), D560 (= D577), E744 (= E761), R753 (= R770)
- binding calcium ion: D542 (= D559), D544 (= D561), D546 (= D563), I548 (= I565), D550 (≠ E567)
7w2wA Crystal structure of txgh116 r786k mutant from thermoanaerobacterium xylanolyticum with glucose
38% identity, 98% coverage: 4:783/798 of query aligns to 8:767/771 of 7w2wA
- binding beta-D-glucopyranose: E409 (= E419), Y413 (= Y423), D420 (= D430), H475 (= H491), Y491 (≠ T507), T559 (= T575), D561 (= D577), W700 (= W719), E745 (= E761)
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding alpha-D-glucopyranose: E409 (= E419), D420 (= D430), H475 (= H491), Y491 (≠ T507), T559 (= T575), W700 (= W719), E745 (= E761), Y758 (= Y774)
8i5sA Crystal structure of txgh116 d593n acid/base mutant from thermoanaerobacterium xylanolyticum with 2-deoxy-2-fluoroglucoside (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 8:767/769 of 8i5sA
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: E409 (= E419), Y413 (= Y423), D420 (= D430), H475 (= H491), T559 (= T575), E745 (= E761), R754 (= R770)
- binding 2,4-dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside: G257 (= G268), D258 (= D269), S260 (= S271), D261 (≠ E272), H264 (≠ Q275), Q443 (≠ A453), D446 (≠ R456), T447 (≠ A457), L477 (= L493), W485 (= W501), I488 (≠ T504)
8r06A Crystal structure of thermoanaerobacterium xylanolyticum gh116 beta- glucosidase with a covalently bound cyclophellitol aziridine (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 6:767/771 of 8r06A
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding (1~{R},2~{S},3~{S},4~{S},5~{R},6~{R})-5-azanyl-6-(hydroxymethyl)cyclohexane-1,2,3,4-tetrol: E409 (= E419), Y413 (= Y423), D420 (= D430), H475 (= H491), T559 (= T575), E745 (= E761), R754 (= R770), Y758 (= Y774)
5ncxA Crystal structure of thermoanaerobacterium xylolyticum gh116 beta- glucosidase with an covalent inhibitor
38% identity, 98% coverage: 4:783/798 of query aligns to 6:767/771 of 5ncxA
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding ~{N}-[(1~{R},2~{R},3~{R},4~{S},5~{S},6~{S})-2-(hydroxymethyl)-3,4,5,6-tetrakis(oxidanyl)cyclohexyl]pentanamide: E409 (= E419), Y413 (= Y423), D420 (= D430), H475 (= H491), Y491 (≠ T507), T559 (= T575), D561 (= D577), E745 (= E761), R754 (= R770), Y758 (= Y774)
7dktA Crystal structure of txgh116 e441a nucleophile mutant from thermoanaerobacterium xylanolyticum with alpha-glucosyl fluoride (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 8:767/769 of 7dktA
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding alpha-D-glucopyranosyl fluoride: Y413 (= Y423), D420 (= D430), H475 (= H491), Y491 (≠ T507), T559 (= T575), W700 (= W719), E745 (= E761), R754 (= R770), Y758 (= Y774)
- binding glycerol: W14 (= W10), T15 (≠ R11), E20 (≠ L16), I151 (≠ L144), Y153 (≠ H146), N154 (≠ D147), K166 (≠ R159), M355 (≠ A367), D357 (≠ A369), N402 (≠ V412), M404 (≠ Q414), F411 (≠ L421), D412 (= D422), Y413 (= Y423), Q439 (≠ A449), R442 (= R452), Q443 (≠ A453), D446 (≠ R456), D452 (= D462), Y481 (≠ N497), I486 (≠ L502), K487 (≠ Q503), I488 (≠ T504), T534 (≠ A550), D537 (≠ R553), D561 (= D577), W563 (= W579), S564 (≠ R580), F622 (≠ L641), S626 (= S645), H628 (≠ S647), D690 (= D709), S692 (≠ K711), Y732 (= Y751), K734 (vs. gap)
7dksA Crystal structure of txgh116 e441a nucleophile mutant from thermoanaerobacterium xylanolyticum (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 8:767/769 of 7dksA
- binding calcium ion: D543 (= D559), D545 (= D561), D547 (= D563), I549 (= I565), D551 (≠ E567)
- binding glycerol: K166 (≠ R159), D357 (≠ A369), N402 (≠ V412), D412 (= D422), Y413 (= Y423), Q439 (≠ A449), R442 (= R452), D446 (≠ R456), Y481 (≠ N497), W493 (≠ Y509), T559 (= T575), D561 (= D577), D561 (= D577), W563 (= W579), S564 (≠ R580), F622 (≠ L641), S626 (= S645), H628 (≠ S647), D690 (= D709), S692 (≠ K711), W700 (= W719), E745 (= E761), R754 (= R770)
7w2tA Crystal structure of txgh116 e730q mutant from thermoanaerobacterium xylanolyticum with glucose
38% identity, 98% coverage: 4:783/798 of query aligns to 8:769/773 of 7w2tA
- binding beta-D-glucopyranose: E411 (= E419), Y415 (= Y423), D422 (= D430), H477 (= H491), Y493 (≠ T507), T561 (= T575), W702 (= W719), E747 (= E761), R756 (= R770)
- binding calcium ion: D545 (= D559), D547 (= D561), D549 (= D563), I551 (= I565), D553 (≠ E567)
5npfA Crystal structure of txgh116 (beta-glucosidase from thermoanaerobacterium xylolyticum) in complex with beta cyclophellitol cyclosulfate probe me594 (see paper)
37% identity, 98% coverage: 4:783/798 of query aligns to 8:761/763 of 5npfA
- binding [(1~{R},2~{R},3~{R},4~{S},5~{R})-2-(hydroxymethyl)-3,4,5,6-tetrakis(oxidanyl)cyclohexyl] hydrogen sulfate: E403 (= E419), Y407 (= Y423), D414 (= D430), H469 (= H491), Y485 (≠ T507), T553 (= T575), D555 (= D577), E739 (= E761), R748 (= R770)
- binding calcium ion: D537 (= D559), D539 (= D561), D541 (= D563), I543 (= I565), D545 (≠ E567)
5ostA Beta-glucosidase from thermoanaerobacterium xylolyticum gh116 in complex with gluco-1h-imidazole (see paper)
38% identity, 98% coverage: 4:783/798 of query aligns to 4:760/762 of 5ostA
- binding (4~{S},5~{S},6~{R},7~{R})-7-(hydroxymethyl)-4,5,6,7-tetrahydro-1~{H}-benzimidazole-4,5,6-triol: E402 (= E419), Y406 (= Y423), D413 (= D430), H468 (= H491), Y484 (≠ T507), T552 (= T575), D554 (= D577), E738 (= E761), R747 (= R770)
- binding calcium ion: D536 (= D559), D538 (= D561), D540 (= D563), I542 (= I565), D544 (≠ E567)
5fjsA Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (gba2) (see paper)
37% identity, 98% coverage: 4:783/798 of query aligns to 4:729/733 of 5fjsA
5fjsB Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (gba2) (see paper)
37% identity, 98% coverage: 4:783/798 of query aligns to 5:698/702 of 5fjsB
Q7KT91 Non-lysosomal glucosylceramidase; NLGase; EC 3.2.1.45 from Drosophila melanogaster (Fruit fly) (see paper)
27% identity, 86% coverage: 98:783/798 of query aligns to 209:936/948 of Q7KT91
- S214 (= S107) modified: Phosphoserine
- S667 (≠ W579) modified: Phosphoserine
- S669 (≠ L581) modified: Phosphoserine
8ic7A Exo-beta-d-arabinofuranosidase exoma2 from microbacterium arabinogalactanolyticum in complex with beta-d-arabinofuranose (see paper)
28% identity, 33% coverage: 524:783/798 of query aligns to 505:769/853 of 8ic7A
- binding beta-D-arabinofuranose: T553 (= T575), D555 (= D577), R680 (vs. gap), W712 (= W719), E755 (≠ F769), C756 (≠ R770), R762 (= R776)
- binding magnesium ion: D539 (= D559), D541 (= D561), D543 (= D563), L545 (≠ I565), D547 (≠ E567)
Sites not aligning to the query:
8ic6B Exo-beta-d-arabinanase exoma2 from microbacterium arabinogalactanolyticum in complex with tris (see paper)
28% identity, 33% coverage: 524:783/798 of query aligns to 506:770/855 of 8ic6B
Sites not aligning to the query:
Query Sequence
>Synpcc7942_0854 FitnessBrowser__SynE:Synpcc7942_0854
MTYELPAAAWRRPLGLGWEKPYTVRYASNLDDGPWHGAPLGGFGAGCWGRSPRGDVTLWH
LDGGEHWYGSIPACQFAVYESGTGAYALSTEAPSDGSLSSWNWYPASTAERSTGEYSALY
PRSQFSYQQVFEAEIHCRQFSPILPHDYQATSYPTAIFRWQLHNPSDRPLTISILLSWEN
LCGWFTNTNKAPEVVYRDDGSPVYDYVPALGQSVGNLNQRIAGEGWQGLLLDQTRSQDPE
EGDGQWAIAIAEAEGLEIFRCDRWDPTGDGSELWQSFALDGSIPDRQDSQPAAAGERLAG
AIAVRLTLQPGESREIPFSIAWDLPVTEFAAGVKAFRRYTDFFGRDGRNAAAIAATGLKH
YDEWEQAIAAWQQPILDRDDLSDTFKLGLFNELYDLCSGGSLWTAASEADPVGQFAVLEC
LDYAWYESLDVRLYGAFGLLMLWPELEKAVMRAFARAIPQADDRTRVIGYWFTIGQESPL
AKRKLANATPHDLGAPNESPWLQTNYTGYQDCNLWKDLGCDFVLQVWRDYQLTGSSDRGF
LSDCWPAAVAALRYLKDFDLDGDGIPENSGAPDQTFDDWRLQGISAYCGGLWIAALEAAL
AIADVLELSAEDRDRQDFQSWLAQARSLYHDTLWNGRYYQLDSGSGSQVVMADQLCGDFY
SRLLQLPPVAPLEAAQSTADMVYEACFQKFHSGQFGLANGLLPDGSPVDPKGTHPLEVWT
GINFGIAAYWLLLGHRDRCFEVTETVIRQIYDNGLQFRTPEAITANATFRASHYLRPMAI
WAVYGVLTNFSPVDQQPV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory