Comparing Synpcc7942_0881 FitnessBrowser__SynE:Synpcc7942_0881 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
3mwbA The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
34% identity, 96% coverage: 9:287/291 of query aligns to 6:286/306 of 3mwbA
3mwbB The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
34% identity, 96% coverage: 9:287/291 of query aligns to 6:283/303 of 3mwbB
2qmxA The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls (see paper)
32% identity, 94% coverage: 6:279/291 of query aligns to 4:277/278 of 2qmxA
P0A9J8 Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 from Escherichia coli (strain K12)
31% identity, 93% coverage: 6:277/291 of query aligns to 106:377/386 of P0A9J8
Sites not aligning to the query:
7am0B Gqqa- a novel type of quorum quenching acylases (see paper)
30% identity, 96% coverage: 3:280/291 of query aligns to 1:274/278 of 7am0B
6vh5D Crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine
27% identity, 86% coverage: 31:279/291 of query aligns to 29:280/282 of 6vh5D
3luyA Putative chorismate mutase from bifidobacterium adolescentis
27% identity, 95% coverage: 1:275/291 of query aligns to 1:283/326 of 3luyA
7alzA Gqqa- a novel type of quorum quenching acylases (see paper)
36% identity, 35% coverage: 179:280/291 of query aligns to 85:190/194 of 7alzA
5jk5A Phenylalanine hydroxylase from dictyostelium - bh2 complex
43% identity, 18% coverage: 197:247/291 of query aligns to 5:57/400 of 5jk5A
Sites not aligning to the query:
5jk8A Phenylalanine hydroxylase from dictyostelium - bh2, norleucine complex
43% identity, 18% coverage: 197:247/291 of query aligns to 5:57/390 of 5jk8A
Sites not aligning to the query:
>Synpcc7942_0881 FitnessBrowser__SynE:Synpcc7942_0881
MSERAIAHLGPVGTYAEMAALRFQAWLTQQDQQPSRLLACRSIPATLQTLADGAVDYAVV
PVENSVEGSVAATLDSLWQLPQLSIQRALILPIAHALISFESDRTAIRQVLSHPQALAQC
QQWLQRHLPQAELIPANSTTEALQDLERHPQRAVIASTRAAELYQMPIQSFPINDSPDNR
TRFWVISRSPTPGGACTSLNFSLDANVPGALVKPLQILADRRINLSRIESRPTKRSLGEY
LFFLDLEADLRDPAIAAAVQAVADCTEQLRVLGSYDSLDFTQSVLVPAQAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory