SitesBLAST
Comparing Synpcc7942_0923 FitnessBrowser__SynE:Synpcc7942_0923 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gljA Crystal structure of methylthioadenosine phosphorylase in complex with rhodamine b (see paper)
59% identity, 97% coverage: 6:286/291 of query aligns to 6:286/287 of 4gljA
- active site: D212 (= D212), D214 (= D214)
- binding N-[9-(2-carboxyphenyl)-6-(diethylamino)-3H-xanthen-3-ylidene]-N-ethylethanaminium: S12 (= S12), Y15 (= Y15), H55 (= H55), A88 (= A88), G90 (= G90), F169 (= F169), F169 (= F169), I186 (= I186), G187 (= G187), M188 (= M188), D212 (= D212), F213 (≠ Y213), D214 (= D214), N219 (≠ D219), A228 (≠ V228), I229 (= I229), L232 (= L232)
6dz0A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((pent-4-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
44% identity, 88% coverage: 2:257/291 of query aligns to 2:260/274 of 6dz0A
- active site: T12 (≠ S12), P35 (= P35), H59 (= H59), I61 (≠ L61), M62 (≠ L62), A88 (= A88), M190 (= M188), T191 (= T189), D214 (= D212), D216 (= D214), V227 (= V225)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(pent-4-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T12 (≠ S12), H59 (= H59), A88 (= A88), C89 (≠ V89), G90 (= G90), F171 (= F169), I188 (= I186), N189 (≠ G187), M190 (= M188), T213 (= T211), D214 (= D212), D216 (= D214), V227 (= V225), V230 (= V228)
- binding phosphate ion: G11 (= G11), T12 (≠ S12), R54 (= R54), H55 (= H55), T87 (≠ S87), T191 (= T189)
5eubA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
43% identity, 87% coverage: 4:257/291 of query aligns to 1:257/272 of 5eubA
- active site: T9 (≠ S12), P32 (= P35), H56 (= H59), I58 (≠ L61), M59 (≠ L62), A85 (= A88), M187 (= M188), T188 (= T189), D211 (= D212), D213 (= D214), V224 (= V225)
- binding (2~{R},3~{R},4~{S},5~{S})-2-[2,6-bis(azanyl)purin-9-yl]-5-(methylsulfanylmethyl)oxolane-3,4-diol: A85 (= A88), C86 (≠ V89), G87 (= G90), F168 (= F169), I185 (= I186), N186 (≠ G187), T210 (= T211), D211 (= D212), D213 (= D214), V227 (= V228)
6dz3A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-butyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
43% identity, 87% coverage: 4:257/291 of query aligns to 2:258/273 of 6dz3A
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V225 (= V225)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-butyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: T84 (≠ A86), A86 (= A88), C87 (≠ V89), G88 (= G90), F169 (= F169), I186 (= I186), N187 (≠ G187), M188 (= M188), D212 (= D212), D214 (= D214), V228 (= V228), L232 (= L232)
6dyzA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
43% identity, 87% coverage: 4:257/291 of query aligns to 2:258/273 of 6dyzA
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V225 (= V225)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(prop-2-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S12), H57 (= H59), A86 (= A88), C87 (≠ V89), G88 (= G90), F169 (= F169), I186 (= I186), N187 (≠ G187), M188 (= M188), D212 (= D212), D214 (= D214), V228 (= V228)
- binding phosphate ion: G9 (= G11), T10 (≠ S12), R52 (= R54), H53 (= H55), T85 (≠ S87), A86 (= A88), T189 (= T189)
5tc8A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with methylthio-dadme-immucillin-a
43% identity, 87% coverage: 4:257/291 of query aligns to 2:258/273 of 5tc8A
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V225 (= V225)
- binding (3r,4s)-1-[(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol: T10 (≠ S12), A86 (= A88), C87 (≠ V89), G88 (= G90), F169 (= F169), I186 (= I186), N187 (≠ G187), M188 (= M188), T211 (= T211), D212 (= D212), D214 (= D214), V228 (= V228)
5tc6A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with propylthio-immucillin-a
43% identity, 87% coverage: 4:257/291 of query aligns to 2:258/273 of 5tc6A
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V225 (= V225)
- binding (2S,3S,4R,5S)-2-(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(propylsulfanyl)methyl]pyrrolidine-3,4-diol: T10 (≠ S12), A86 (= A88), C87 (≠ V89), G88 (= G90), F169 (= F169), N187 (≠ G187), M188 (= M188), D212 (= D212), V225 (= V225), V228 (= V228), L229 (≠ I229)
3ozcA Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
43% identity, 87% coverage: 4:257/291 of query aligns to 2:258/273 of 3ozcA
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V225 (= V225)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(4-chlorophenyl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S12), H57 (= H59), A86 (= A88), C87 (≠ V89), G88 (= G90), F169 (= F169), I186 (= I186), N187 (≠ G187), M188 (= M188), D212 (= D212), D214 (= D214), V228 (= V228), L229 (≠ I229)
5tc5A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride
43% identity, 87% coverage: 4:257/291 of query aligns to 15:271/286 of 5tc5A
- active site: T23 (≠ S12), P46 (= P35), H70 (= H59), I72 (≠ L61), M73 (≠ L62), A99 (= A88), M201 (= M188), T202 (= T189), D225 (= D212), D227 (= D214), V238 (= V225)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(butylsulfanyl)methyl]pyrrolidin-3-ol: A99 (= A88), C100 (≠ V89), G101 (= G90), F182 (= F169), I199 (= I186), M201 (= M188), D225 (= D212), D227 (= D214), V241 (= V228)
1sd2A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin (see paper)
45% identity, 87% coverage: 4:257/291 of query aligns to 2:247/262 of 1sd2A
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M182 (= M188), T183 (= T189), D206 (= D212), D208 (= D214), V214 (= V225)
- binding 2-(4-amino-pyrrolo[2,3-d]pyrimidin-7-yl)-5-methylsulfanylmethyl-tetrahydro-furan-3,4-diol: C87 (≠ V89), G88 (= G90), F163 (= F169), I180 (= I186), N181 (≠ G187), M182 (= M188), D206 (= D212), V217 (= V228)
1k27A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue (see paper)
43% identity, 87% coverage: 4:257/291 of query aligns to 2:255/270 of 1k27A
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V222 (= V225)
- binding (3s,4r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(methylsulfanyl)methyl]pyrrolidine-3,4-diol: A86 (= A88), C87 (≠ V89), G88 (= G90), F169 (= F169), N187 (≠ G187), M188 (= M188), D212 (= D212), V225 (= V228)
- binding phosphate ion: G9 (= G11), T10 (≠ S12), R52 (= R54), H53 (= H55), T85 (≠ S87), A86 (= A88), T189 (= T189)
1sd1A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a (see paper)
43% identity, 87% coverage: 4:257/291 of query aligns to 2:253/268 of 1sd1A
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V220 (= V225)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: A86 (= A88), C87 (≠ V89), G88 (= G90), F169 (= F169), I186 (= I186), N187 (≠ G187), M188 (= M188), D212 (= D212), D214 (= D214)
1cg6A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-deoxy-5'-methylthioadenosine and sulfate at 1.7 a resolution (see paper)
43% identity, 87% coverage: 4:257/291 of query aligns to 2:253/268 of 1cg6A
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V220 (= V225)
- binding 5'-deoxy-5'-methylthioadenosine: A86 (= A88), C87 (≠ V89), G88 (= G90), F169 (= F169), N187 (≠ G187), M188 (= M188), D212 (= D212), V223 (= V228)
- binding sulfate ion: G9 (= G11), T10 (≠ S12), R52 (= R54), H53 (= H55), T85 (≠ S87), T189 (= T189)
1cb0A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7 a resolution (see paper)
43% identity, 87% coverage: 4:257/291 of query aligns to 2:253/268 of 1cb0A
- active site: T10 (≠ S12), P33 (= P35), H57 (= H59), I59 (≠ L61), M60 (≠ L62), A86 (= A88), M188 (= M188), T189 (= T189), D212 (= D212), D214 (= D214), V220 (= V225)
- binding adenine: C87 (≠ V89), G88 (= G90), F169 (= F169), D212 (= D212), D214 (= D214)
3t94A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate (see paper)
44% identity, 91% coverage: 3:268/291 of query aligns to 7:270/270 of 3t94A
- active site: S16 (= S12), P39 (= P35), H63 (= H59), I65 (≠ L61), P66 (≠ L62), A92 (= A88), M190 (= M188), T191 (= T189), D214 (= D212), D216 (= D214), A225 (≠ V225)
- binding 5'-deoxy-5'-methylthioadenosine: G94 (= G90), F170 (= F169), I188 (= I186), M190 (= M188), D214 (= D212), A225 (≠ V225), V228 (= V228)
Q97W94 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; MTAPII; EC 2.4.2.28 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
44% identity, 91% coverage: 3:268/291 of query aligns to 7:270/270 of Q97W94
- C138 (= C134) modified: Disulfide link with 205
- C200 (≠ R198) modified: Disulfide link with 262
- C205 (≠ A203) modified: Disulfide link with 138
- C259 (≠ A259) modified: Disulfide link with 261; mutation to S: Reduces thermostability of the enzyme; when associated with S-261.
- C261 (vs. gap) modified: Disulfide link with 259; mutation to S: Reduces thermostability of the enzyme; when associated with S-259.
- C262 (vs. gap) modified: Disulfide link with 200; mutation to S: Reduces thermostability of the enzyme.
Q8U4Q8 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; PfMTAP; EC 2.4.2.28 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
44% identity, 84% coverage: 5:247/291 of query aligns to 3:237/257 of Q8U4Q8
- C130 (= C134) modified: Disulfide link with 195
- C195 (≠ A203) modified: Disulfide link with 130
Sites not aligning to the query:
- 246 modified: Disulfide link with 248
- 248 modified: Disulfide link with 246
6dz2A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
43% identity, 87% coverage: 4:257/291 of query aligns to 2:255/270 of 6dz2A
- active site: T10 (≠ S12), P33 (= P35), I56 (≠ L61), M57 (≠ L62), A83 (= A88), M185 (= M188), T186 (= T189), D209 (= D212), D211 (= D214), V222 (= V225)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-benzyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: G8 (= G10), T10 (≠ S12), T81 (≠ A86), T82 (≠ S87), A83 (= A88), C84 (≠ V89), G85 (= G90), F166 (= F169), I183 (= I186), N184 (≠ G187), M185 (= M188), D209 (= D212), L229 (= L232)
1wtaA Crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)
46% identity, 85% coverage: 6:251/291 of query aligns to 12:254/273 of 1wtaA
5f7jB Crystal structure of mutant n87t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine (see paper)
37% identity, 90% coverage: 1:263/291 of query aligns to 1:283/291 of 5f7jB
- active site: K34 (≠ D34), H59 (= H59), D230 (= D212), D232 (= D214)
- binding adenine: A88 (= A88), C89 (≠ V89), G90 (= G90), F187 (= F169), V204 (≠ I186), N205 (≠ G187), M206 (= M188), D230 (= D212), D232 (= D214), V246 (= V228)
Query Sequence
>Synpcc7942_0923 FitnessBrowser__SynE:Synpcc7942_0923
MTQVRIGIIGGSGLYRMEALKDVEEVRVETAFGDPSDALIVGNLDGVPVAFLARHGRHHQ
LLPTEVPYRANILAMKQLGVEYILSASAVGSLQAEIAPLDLVIPDQFIDRTFARPSTFFG
NGLVGHVTFGDPFCPALSQLLAEAVSLAEIPEIKLHQGGTYVCMEGPAFSTKAESQLYRS
WGAQIIGMTNLTEAKLAREAEIAYATLALVTDYDCWHPDHDSVTVEMVIANLHKNATNAQ
KVVRSAVGLLSDRWPESAAHEALRYALMTPPEHVPAETRQRLALLLQKYWG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory