Comparing Synpcc7942_0931 FitnessBrowser__SynE:Synpcc7942_0931 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4eqyG Crystal structure of acyl-[acyl-carrier-protein]--udp-n- acetylglucosamine o-acyltransferase from burkholderia thailandensis (see paper)
42% identity, 94% coverage: 5:256/268 of query aligns to 2:255/260 of 4eqyG
6p9tA E.Coli lpxa in complex with udp-3-o-(r-3-hydroxymyristoyl)-glcnac and compound 8 (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/263 of 6p9tA
6p9sA E.Coli lpxa in complex with udp-3-o-(r-3-hydroxymyristoyl)-glcnac and compound 7 (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/263 of 6p9sA
6p9rA E.Coli lpxa in complex with udp-3-o-(r-3-hydroxymyristoyl)-glcnac and compound 6 (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/263 of 6p9rA
6p9qA E.Coli lpxa in complex with udp-3-o-(r-3-hydroxymyristoyl)-glcnac and compound 2 (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/263 of 6p9qA
6p9pA E.Coli lpxa in complex with compound 1 (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/263 of 6p9pA
2qivX Structural basis for the acyl chain selectivity and mechanism of udp- n-acetylglucosamine acyltransferase (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/262 of 2qivX
2qiaA Structural basis for the acyl chain selectivity and mechanism of udp- n-acetylglucosamine acyltransferase (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/262 of 2qiaA
2jf3A Nucleotide substrate binding by udp-n-acetylglucosamine acyltransferase (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/262 of 2jf3A
2aq9A Structure of e. Coli lpxa with a bound peptide that is competitive with acyl-acp (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 5:241/262 of 2aq9A
Sites not aligning to the query:
7okcA Crystal structure of escherichia coli lpxa in complex with compound 1 (see paper)
45% identity, 90% coverage: 2:241/268 of query aligns to 7:243/264 of 7okcA
3i3xA Structural basis for the sugar nucleotide and acyl chain selectivity of leptospira interrogans lpxa (see paper)
40% identity, 94% coverage: 5:256/268 of query aligns to 3:252/259 of 3i3xA
3i3aA Structural basis for the sugar nucleotide and acyl chain selectivity of leptospira interrogans lpxa (see paper)
40% identity, 94% coverage: 5:256/268 of query aligns to 3:252/259 of 3i3aA
Sites not aligning to the query:
7t61A P. Aeruginosa lpxa in complex with ligand l15 (see paper)
40% identity, 83% coverage: 3:224/268 of query aligns to 1:219/257 of 7t61A
7t60A P. Aeruginosa lpxa in complex with ligand l13 (see paper)
40% identity, 83% coverage: 3:224/268 of query aligns to 1:219/257 of 7t60A
7t5zA P. Aeruginosa lpxa in complex with ligand l8 (see paper)
40% identity, 83% coverage: 3:224/268 of query aligns to 1:219/257 of 7t5zA
7t5xA P. Aeruginosa lpxa in complex with ligand l6 (see paper)
40% identity, 83% coverage: 3:224/268 of query aligns to 1:219/257 of 7t5xA
7t5sA P. Aeruginosa lpxa in complex with ligand h16 (see paper)
40% identity, 83% coverage: 3:224/268 of query aligns to 1:219/257 of 7t5sA
7t5rA P. Aeruginosa lpxa in complex with ligand h7 (see paper)
40% identity, 83% coverage: 3:224/268 of query aligns to 1:219/257 of 7t5rA
7okbA Crystal structure of pseudomonas aeruginosa lpxa in complex with compound 45 (see paper)
40% identity, 83% coverage: 3:224/268 of query aligns to 2:220/258 of 7okbA
>Synpcc7942_0931 FitnessBrowser__SynE:Synpcc7942_0931
VSAVIHPTAIIAPGAEIHPSVQIGPYAVIGEHVRIGAHTTVGAHAVIDGWTEIGEENRIF
PGAAIGLESQDKKTDGSLSVVRIGDRNRIREYVTINRATKAGEATVIGNDNLLMAYVHVA
HNCILHNRIVISNAVSLAGHIVVESGAVIGGMSGLHQFVHVGRNAMIGGMSRVERDVPPY
MLVEGNPARVRSLNLVGLERAGLRDGQEGEAFKQLKQAYRLLYRSDLLLKEAIAEIRQIS
DLEHLQHLCNFLEASQGSERRGPTPGSK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory