SitesBLAST
Comparing Synpcc7942_0946 FitnessBrowser__SynE:Synpcc7942_0946 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7emeA Putative leptospira interrogans recombinant l-amino acid oxidase
24% identity, 88% coverage: 40:476/495 of query aligns to 1:413/413 of 7emeA
- binding flavin-adenine dinucleotide: G8 (= G47), G10 (= G49), S12 (≠ A51), I30 (= I69), E31 (= E70), A32 (≠ Y71), G38 (= G77), R39 (= R78), A55 (≠ G94), E56 (≠ G95), W57 (≠ H96), Y176 (≠ Q234), V206 (= V265), L235 (≠ I294), Q239 (≠ V298), I265 (≠ T324), F359 (≠ W422), I360 (= I423), G363 (≠ S426), G389 (= G452), E390 (≠ D453), T398 (≠ W461), V399 (= V462)
8p84B X-ray structure of thermoanaerobacterales bacterium monoamine oxidase (see paper)
27% identity, 88% coverage: 43:476/495 of query aligns to 6:445/450 of 8p84B
- binding flavin-adenine dinucleotide: V9 (≠ L46), G10 (= G47), G12 (= G49), A14 (= A51), E33 (= E70), A34 (≠ Y71), R35 (≠ Q72), G40 (= G77), R41 (= R78), T42 (≠ L79), G56 (= G87), Q57 (= Q88), W58 (≠ F89), V234 (= V265), V262 (≠ I294), W383 (= W417), W388 (= W422), C392 (≠ S426), Y393 (≠ F427), G420 (= G452), T421 (≠ D453), G429 (= G460), Y430 (≠ W461), I431 (≠ V462), A434 (= A465)
- binding magnesium ion: E125 (≠ T168), H188 (vs. gap)
2z5xA Crystal structure of human monoamine oxidase a with harmine (see paper)
22% identity, 88% coverage: 43:479/495 of query aligns to 5:451/513 of 2z5xA
- active site: G60 (≠ R98), R195 (≠ N235), K294 (= K326)
- binding decyl(dimethyl)phosphine oxide: V104 (≠ Q147), W105 (≠ E148), Y110 (≠ V153)
- binding flavin-adenine dinucleotide: I8 (≠ L46), G9 (= G47), G11 (= G49), I12 (≠ M50), S13 (≠ A51), L31 (≠ I69), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), G55 (= G93), G56 (= G94), A57 (≠ G95), Y58 (≠ H96), P232 (= P264), V233 (= V265), I262 (= I294), L266 (≠ V298), W386 (= W422), Y391 (≠ F427), C395 (vs. gap), Y396 (vs. gap), G423 (= G452), T424 (≠ D453), G432 (= G460), Y433 (≠ W461), M434 (≠ V462)
- binding 7-methoxy-1-methyl-9h-beta-carboline: I169 (≠ T213), F197 (= F237), Q204 (≠ D244), I324 (≠ R355), L326 (≠ I357), F341 (= F372), Y396 (vs. gap)
Sites not aligning to the query:
P21397 Amine oxidase [flavin-containing] A; Monoamine oxidase type A; MAO-A; EC 1.4.3.21; EC 1.4.3.4 from Homo sapiens (Human) (see 6 papers)
22% identity, 88% coverage: 43:476/495 of query aligns to 16:459/527 of P21397
- C165 (≠ G198) mutation to S: No loss of activity.
- E188 (vs. gap) to K: in dbSNP:rs77698881
- C266 (≠ G287) to F: found in a family with Brunner syndrome-like behavioral disturbances; likely pathogenic; reduced activity; dbSNP:rs587777457; mutation to S: No loss of activity.
- C306 (≠ V327) mutation to S: No loss of activity.
- C321 (≠ H342) mutation to S: No loss of activity.
- C323 (≠ W344) mutation to S: No loss of activity.
- C374 (≠ V395) mutation to S: Complete loss of activity.
- C398 (≠ I423) mutation to S: No loss of activity.
- C406 (vs. gap) modified: S-8alpha-FAD cysteine; mutation to S: Complete loss of activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
- 15 D → E: in a breast cancer sample; somatic mutation
2yg4A Structure-based redesign of cofactor binding in putrescine oxidase: wild type bound to putrescine (see paper)
25% identity, 89% coverage: 37:476/495 of query aligns to 1:446/449 of 2yg4A
- active site: S61 (≠ R98), S196 (vs. gap), K295 (= K326)
- binding 4-hydroxybutan-1-aminium: G171 (= G212), E323 (= E354), Y394 (≠ F427)
- binding flavin-adenine dinucleotide: V10 (≠ L46), G11 (= G47), G13 (= G49), P14 (≠ M50), S15 (≠ A51), E34 (= E70), A35 (≠ Y71), R36 (≠ Q72), G41 (= G77), R42 (= R78), G56 (= G93), G57 (= G94), Q58 (≠ G95), W59 (≠ H96), V234 (= V265), V263 (≠ I294), W384 (= W417), W389 (= W422), Y394 (≠ F427), C421 (vs. gap), S422 (≠ G452), Q430 (≠ G460), H431 (≠ W461), V432 (= V462)
2yg3B Structure-based redesign of cofactor binding in putrescine oxidase: wild type enzyme (see paper)
25% identity, 89% coverage: 37:476/495 of query aligns to 1:446/450 of 2yg3B
- active site: S61 (≠ R98), S196 (vs. gap), K295 (= K326)
- binding flavin-adenine dinucleotide: V10 (≠ L46), G11 (= G47), G13 (= G49), P14 (≠ M50), S15 (≠ A51), E34 (= E70), A35 (≠ Y71), R36 (≠ Q72), G41 (= G77), R42 (= R78), G56 (= G93), G57 (= G94), Q58 (≠ G95), W59 (≠ H96), V234 (= V265), V263 (≠ I294), W384 (= W417), W389 (= W422), Y394 (≠ F427), C421 (vs. gap), S422 (≠ G452), Q430 (≠ G460), H431 (≠ W461), V432 (= V462), A435 (= A465)
2bxrA Human monoamine oxidase a in complex with clorgyline, crystal form a (see paper)
22% identity, 88% coverage: 43:479/495 of query aligns to 5:443/445 of 2bxrA
- active site: G60 (≠ R98), R190 (≠ N235), K286 (= K326)
- binding flavin-adenine dinucleotide: I8 (≠ L46), G9 (= G47), G11 (= G49), S13 (≠ A51), L31 (≠ I69), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), G55 (= G93), G56 (= G94), A57 (≠ G95), Y58 (≠ H96), P224 (= P264), V225 (= V265), I254 (= I294), W378 (= W422), Y383 (≠ F427), C387 (vs. gap), Y388 (vs. gap), G415 (= G452), T416 (≠ D453), G424 (= G460), Y425 (≠ W461), M426 (≠ V462), A429 (= A465)
- binding n-[3-(2,4-dichlorophenoxy)propyl]-n-methyl-n-prop-2-ynylamine: I316 (≠ R355), L318 (≠ I357), F333 (= F372), Y388 (vs. gap)
7b0zA Crystal structure of human monoamine oxidase b in complex with (e)-3- phenyl-1-(4-(trifluoromethyl)phenyl)prop-2-en-1-one (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 13:449/498 of 7b0zA
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ R195), W156 (≠ G199)
- binding flavin-adenine dinucleotide: S14 (≠ A51), L32 (≠ I69), E33 (= E70), A34 (≠ Y71), R35 (≠ Q72), G40 (= G77), R41 (= R78), G56 (= G93), G57 (= G94), S58 (≠ G95), Y59 (≠ H96), P233 (= P264), V234 (= V265), I263 (= I294), W387 (= W417), Y392 (≠ W422), C396 (≠ S426), Y397 (≠ F427), G424 (= G452), T425 (≠ D453), G433 (= G460), Y434 (≠ W461), M435 (≠ V462)
- binding (E)-3-phenyl-1-(4-(trifluoromethyl)phenyl)prop-2-en-1-one: Y59 (≠ H96), L170 (≠ A209), C171 (≠ H210), I198 (≠ F237), Q205 (vs. gap), I315 (≠ P345), Y325 (≠ R355), Y397 (≠ F427), Y434 (≠ W461)
Sites not aligning to the query:
7b0vA Crystal structure of human monoamine oxidase b in complex with (e)-3- phenyl-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 13:449/498 of 7b0vA
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ R195), K153 (≠ Q196), W156 (≠ G199)
- binding flavin-adenine dinucleotide: S14 (≠ A51), L32 (≠ I69), E33 (= E70), A34 (≠ Y71), R35 (≠ Q72), G40 (= G77), R41 (= R78), G56 (= G93), G57 (= G94), S58 (≠ G95), Y59 (≠ H96), V234 (= V265), I263 (= I294), W387 (= W417), Y392 (≠ W422), C396 (≠ S426), Y397 (≠ F427), G424 (= G452), T425 (≠ D453), G433 (= G460), Y434 (≠ W461), M435 (≠ V462)
- binding (E)-3-phenyl-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one: W118 (≠ Y160), F167 (vs. gap), L170 (≠ A209), C171 (≠ H210), I198 (≠ F237), Q205 (vs. gap), I315 (≠ P345), Y325 (≠ R355)
Sites not aligning to the query:
7zw3AAA Amine oxidase [flavin-containing] B (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 13:449/500 of 7zw3AAA
- binding 1-(8-oxidanylquinolin-2-yl)-N-(phenylmethyl)methanimine oxide: W118 (≠ Y160), L163 (= L206), F167 (vs. gap), L170 (≠ A209), I198 (≠ F237), Q205 (vs. gap), Y325 (≠ R355), Y397 (≠ F427)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ R195), K153 (≠ Q196)
- binding flavin-adenine dinucleotide: S14 (≠ A51), L32 (≠ I69), E33 (= E70), A34 (≠ Y71), R35 (≠ Q72), G40 (= G77), R41 (= R78), G56 (= G93), G57 (= G94), S58 (≠ G95), Y59 (≠ H96), P233 (= P264), V234 (= V265), I263 (= I294), W387 (= W417), Y392 (≠ W422), C396 (≠ S426), Y397 (≠ F427), G424 (= G452), T425 (≠ D453), G433 (= G460), Y434 (≠ W461), M435 (≠ V462)
Sites not aligning to the query:
6yt2A Crystal structure of human monoamine oxidase b in complex with diphenylene iodonium (dpi) (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 13:449/500 of 6yt2A
- active site: G61 (≠ R98), R196 (≠ N235), K295 (= K326)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ R195), K153 (≠ Q196), W156 (≠ G199)
- binding flavin-adenine dinucleotide: S14 (≠ A51), L32 (≠ I69), E33 (= E70), A34 (≠ Y71), R35 (≠ Q72), G40 (= G77), R41 (= R78), G56 (= G93), G57 (= G94), S58 (≠ G95), Y59 (≠ H96), P233 (= P264), V234 (= V265), I263 (= I294), W387 (= W417), Y392 (≠ W422), C396 (≠ S426), Y397 (≠ F427), G424 (= G452), T425 (≠ D453), G433 (= G460), Y434 (≠ W461), M435 (≠ V462), A438 (= A465)
- binding benzo[b][1]benziodole: Y59 (≠ H96), L170 (≠ A209), C171 (≠ H210), I197 (≠ L236), I198 (≠ F237), Q205 (vs. gap), Y325 (≠ R355), F342 (= F372)
Sites not aligning to the query:
6fw0A Crystal structure of human monoamine oxidase b (mao b) in complex with chlorophenyl-chromone-carboxamide (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 13:449/500 of 6fw0A
- active site: G61 (≠ R98), R196 (≠ N235), K295 (= K326)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ R195), K153 (≠ Q196), W156 (≠ G199)
- binding ~{N}-(3-chlorophenyl)-4-oxidanylidene-chromene-3-carboxamide: F167 (vs. gap), L170 (≠ A209), C171 (≠ H210), I198 (≠ F237), Q205 (vs. gap), Y325 (≠ R355), F342 (= F372), Y397 (≠ F427)
- binding flavin-adenine dinucleotide: S14 (≠ A51), L32 (≠ I69), E33 (= E70), A34 (≠ Y71), R35 (≠ Q72), G40 (= G77), R41 (= R78), G56 (= G93), G57 (= G94), S58 (≠ G95), Y59 (≠ H96), P233 (= P264), V234 (= V265), I263 (= I294), W387 (= W417), Y392 (≠ W422), C396 (≠ S426), Y397 (≠ F427), G424 (= G452), T425 (≠ D453), G433 (= G460), Y434 (≠ W461), M435 (≠ V462)
Sites not aligning to the query:
6fvzA Crystal structure of human monoamine oxidase b (mao b) in complex with dimethylphenyl-chromone-carboxamide (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 13:449/500 of 6fvzA
- active site: G61 (≠ R98), R196 (≠ N235), K295 (= K326)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ R195), W156 (≠ G199)
- binding ~{N}-(3,4-dimethylphenyl)-4-oxidanylidene-chromene-3-carboxamide: F167 (vs. gap), L170 (≠ A209), I198 (≠ F237), Q205 (vs. gap), I315 (≠ P345), Y325 (≠ R355), F342 (= F372), Y397 (≠ F427)
- binding flavin-adenine dinucleotide: S14 (≠ A51), L32 (≠ I69), E33 (= E70), A34 (≠ Y71), R35 (≠ Q72), G40 (= G77), R41 (= R78), G56 (= G93), G57 (= G94), S58 (≠ G95), Y59 (≠ H96), P233 (= P264), V234 (= V265), I263 (= I294), W387 (= W417), Y392 (≠ W422), C396 (≠ S426), Y397 (≠ F427), G424 (= G452), T425 (≠ D453), G433 (= G460), Y434 (≠ W461), M435 (≠ V462)
Sites not aligning to the query:
7p4hA Crystal structure of monoamine oxidase b in complex with inhibitor (+)-2 (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 12:448/499 of 7p4hA
- binding 3,4-dimethyl-7-[[(3~{S})-piperidin-3-yl]methoxy]chromen-2-one: Y58 (≠ H96), L169 (≠ A209), C170 (≠ H210), I197 (≠ F237), Q204 (vs. gap), Y324 (≠ R355)
- binding flavin-adenine dinucleotide: S13 (≠ A51), L31 (≠ I69), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), G55 (= G93), G56 (= G94), S57 (≠ G95), Y58 (≠ H96), P232 (= P264), V233 (= V265), I262 (= I294), W386 (= W417), Y391 (≠ W422), C395 (≠ S426), Y396 (≠ F427), G423 (= G452), T424 (≠ D453), G432 (= G460), Y433 (≠ W461), M434 (≠ V462)
Sites not aligning to the query:
7p4fA Crystal structure of monoamine oxidase b in complex with inhibitor 1 (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 12:448/499 of 7p4fA
- binding 4-(hydroxymethyl)-7-[[4-[[methyl-(phenylmethyl)amino]methyl]phenyl]methoxy]chromen-2-one: Y58 (≠ H96), F101 (≠ W140), W117 (≠ Y160), L162 (= L206), F166 (vs. gap), L169 (≠ A209), I197 (≠ F237), Q204 (vs. gap), Y324 (≠ R355), F341 (= F372), Y396 (≠ F427), Y433 (≠ W461)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ R195), K152 (≠ Q196), W155 (≠ G199)
- binding flavin-adenine dinucleotide: S13 (≠ A51), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), T41 (≠ L79), G55 (= G93), G56 (= G94), S57 (≠ G95), Y58 (≠ H96), P232 (= P264), V233 (= V265), I262 (= I294), W386 (= W417), Y391 (≠ W422), C395 (≠ S426), Y396 (≠ F427), G423 (= G452), T424 (≠ D453), G432 (= G460), Y433 (≠ W461), M434 (≠ V462)
Sites not aligning to the query:
6rleA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 97 (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 12:448/499 of 6rleA
- active site: G60 (≠ R98), R195 (≠ N235), K294 (= K326)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ R195), W155 (≠ G199)
- binding flavin-adenine dinucleotide: S13 (≠ A51), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), G55 (= G93), G56 (= G94), S57 (≠ G95), Y58 (≠ H96), V233 (= V265), I262 (= I294), W386 (= W417), Y391 (≠ W422), C395 (≠ S426), Y396 (≠ F427), G423 (= G452), T424 (≠ D453), G432 (= G460), Y433 (≠ W461), M434 (≠ V462)
- binding 4-[2-(4-propan-2-ylphenyl)ethyl]-1-[(~{E})-prop-1-enyl]piperidine: F166 (vs. gap), L169 (≠ A209), I197 (≠ F237), Q204 (vs. gap), Y324 (≠ R355), Y396 (≠ F427)
Sites not aligning to the query:
6rkpA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 84 (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 12:448/499 of 6rkpA
- active site: G60 (≠ R98), R195 (≠ N235), K294 (= K326)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ R195), W155 (≠ G199)
- binding flavin-adenine dinucleotide: S13 (≠ A51), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), G55 (= G93), G56 (= G94), S57 (≠ G95), Y58 (≠ H96), P232 (= P264), V233 (= V265), I262 (= I294), W386 (= W417), Y391 (≠ W422), C395 (≠ S426), Y396 (≠ F427), G423 (= G452), T424 (≠ D453), G432 (= G460), Y433 (≠ W461), M434 (≠ V462)
- binding 1-[(~{E})-prop-1-enyl]-4-[(~{E})-2-[4-(trifluoromethyl)phenyl]ethenyl]piperidine: P102 (= P141), L169 (≠ A209), I197 (≠ F237), Q204 (vs. gap), I314 (≠ P345), Y324 (≠ R355), F341 (= F372), Y396 (≠ F427)
Sites not aligning to the query:
6rkbA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 1 (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 12:448/499 of 6rkbA
- active site: G60 (≠ R98), R195 (≠ N235), K294 (= K326)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ R195), K152 (≠ Q196)
- binding flavin-adenine dinucleotide: S13 (≠ A51), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), G55 (= G93), G56 (= G94), S57 (≠ G95), Y58 (≠ H96), V233 (= V265), I262 (= I294), W386 (= W417), Y391 (≠ W422), C395 (≠ S426), Y396 (≠ F427), G423 (= G452), T424 (≠ D453), G432 (= G460), Y433 (≠ W461), M434 (≠ V462)
- binding 4-[(~{E})-2-(4-fluorophenyl)ethenyl]-1-[(~{E})-prop-1-enyl]piperidine: L169 (≠ A209), I197 (≠ F237), Q204 (vs. gap), Y324 (≠ R355), Y396 (≠ F427)
Sites not aligning to the query:
6fwcA Crystal structure of human monoamine oxidase b (mao b) in complex with fluorophenyl-chromone-carboxamide (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 12:448/499 of 6fwcA
- active site: G60 (≠ R98), R195 (≠ N235), K294 (= K326)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ R195), K152 (≠ Q196), W155 (≠ G199)
- binding ~{N}-(3-fluorophenyl)-4-oxidanylidene-chromene-3-carboxamide: L169 (≠ A209), C170 (≠ H210), I197 (≠ F237), Q204 (vs. gap), Y324 (≠ R355), F341 (= F372), Y396 (≠ F427)
- binding flavin-adenine dinucleotide: S13 (≠ A51), L31 (≠ I69), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), G55 (= G93), G56 (= G94), S57 (≠ G95), Y58 (≠ H96), V233 (= V265), I262 (= I294), W386 (= W417), Y391 (≠ W422), C395 (≠ S426), Y396 (≠ F427), G423 (= G452), T424 (≠ D453), G432 (= G460), Y433 (≠ W461), M434 (≠ V462)
Sites not aligning to the query:
5mrlA Crystal structure of human monoamine oxidase b (mao b) in complex with n(furan2ylmethyl)nmethylprop2yn1amine (f2mpa) (see paper)
23% identity, 86% coverage: 50:476/495 of query aligns to 12:448/499 of 5mrlA
- active site: G60 (≠ R98), R195 (≠ N235), K294 (= K326)
- binding (~{E})-~{N}-(furan-2-ylmethyl)-~{N}-methyl-prop-1-en-1-amine: L169 (≠ A209), Q204 (vs. gap), Y396 (≠ F427)
- binding flavin-adenine dinucleotide: S13 (≠ A51), E32 (= E70), A33 (≠ Y71), R34 (≠ Q72), G39 (= G77), R40 (= R78), G55 (= G93), G56 (= G94), S57 (≠ G95), Y58 (≠ H96), V233 (= V265), I262 (= I294), W386 (= W417), Y391 (≠ W422), C395 (≠ S426), Y396 (≠ F427), G423 (= G452), T424 (≠ D453), G432 (= G460), Y433 (≠ W461), M434 (≠ V462)
Sites not aligning to the query:
Query Sequence
>Synpcc7942_0946 FitnessBrowser__SynE:Synpcc7942_0946
MRFSRRRFLQSSLGAAATTGLAGTLAAGGQAQTRSTPVRKRSVLVLGAGMAGLTAALSLL
RRGHQVTVIEYQNRIGGRLLSVPLKGGQFSEAGGGHFRANMPYVLSYIRHFKLPLLTLND
GLPRYLFDGKTADAADLSRWPWDLAPQERRVSVASLLNTYLILNGLDTDTVLDANWPDAQ
AIQQLDNLTLSQLIRQVGGSEAFIQLLDAHGGTFTSSSPALGVIPDLAYHFGDQNLFRIQ
GGNDRLPKAMAAAIGSERFILDAPVVAIDQQANRATVTVKDGRTFQGDAIISTIPFTVLP
EVAVRPGWSAGKRRMFAEMEWEQTVKVIAQTRSPVWLAQNVHGWPMAGSDRPWERVIDIT
GNEGGGYGNTFFYLNGRNKDAMLARPKSERAQAIVDQFRSDLPDLFDEVVTLADFAWGEQ
PWIRGSFGGPPLGGAWMIREWTTPEGLIHFAGDFTTMKSGWVEGAIESGLRAARQIDPGA
QPEADTFLRQEQRCN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory