Comparing Synpcc7942_0949 Synpcc7942_0949 permease protein of sugar ABC transporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
36% identity, 89% coverage: 7:266/292 of query aligns to 12:263/285 of 7cagA
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
31% identity, 68% coverage: 67:264/292 of query aligns to 269:476/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
31% identity, 71% coverage: 67:273/292 of query aligns to 284:500/514 of P02916
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
28% identity, 89% coverage: 5:264/292 of query aligns to 32:288/313 of P94529
>Synpcc7942_0949 Synpcc7942_0949 permease protein of sugar ABC transporter
MTHPPRWLTIPALLTITGVFAYPLLRAAWLSLQALNLNTQLQPVFIGLANYQRLWGDSRF
WGDLFNTTVFTVTSVSLELVLGLAIALLLHQPSRWRGPLRTIALLPWVLPTAVMALGWAW
IFNDPYGVWNDWLQQLGWIAAPINWLGNPRWAWLTLVAADVWKTTPFVAILLLAGRQAIP
EDLYEAHCLEGATAWQSFWQITLPLLRPQLAIALLFRSAQAFGLFDLVKVMTGGGPANST
ETLALYAYTTALRYLDFGYGATLAIVTAAILAAGLGLIWGLGRSRSTPSGGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory