SitesBLAST
Comparing Synpcc7942_0978 FitnessBrowser__SynE:Synpcc7942_0978 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ewyA Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
75% identity, 75% coverage: 102:403/403 of query aligns to 3:303/303 of 1ewyA
- active site: Y79 (= Y180), S80 (= S181), C261 (= C361), E301 (= E401), Y303 (= Y403)
- binding flavin-adenine dinucleotide: R77 (= R178), L78 (= L179), Y79 (= Y180), S80 (= S181), C98 (= C199), L102 (= L203), Y104 (= Y205), G115 (= G215), V116 (= V216), C117 (= C217), S118 (= S218), E301 (= E401), Y303 (= Y403)
1queA X-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms (see paper)
75% identity, 75% coverage: 102:403/403 of query aligns to 3:303/303 of 1queA
- active site: Y79 (= Y180), S80 (= S181), C261 (= C361), E301 (= E401), Y303 (= Y403)
- binding flavin-adenine dinucleotide: R77 (= R178), L78 (= L179), Y79 (= Y180), S80 (= S181), C98 (= C199), L102 (= L203), Y104 (= Y205), K105 (≠ Q206), G115 (= G215), V116 (= V216), C117 (= C217), S118 (= S218), T157 (= T257), E301 (= E401), Y303 (= Y403)
- binding sulfate ion: S223 (= S323), R224 (= R324), R233 (= R333), Y235 (= Y335)
1gjrA Ferredoxin-NADP+ reductase complexed with NADP+ by cocrystallization (see paper)
76% identity, 73% coverage: 110:403/403 of query aligns to 1:295/295 of 1gjrA
- active site: Y71 (= Y180), S72 (= S181), C253 (= C361), E293 (= E401), Y295 (= Y403)
- binding flavin-adenine dinucleotide: R69 (= R178), L70 (= L179), Y71 (= Y180), S72 (= S181), C90 (= C199), L94 (= L203), Y96 (= Y205), G107 (= G215), V108 (= V216), C109 (= C217), S110 (= S218), T149 (= T257), E293 (= E401), Y295 (= Y403)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R92 (= R201), L94 (= L203), T147 (= T255), G148 (= G256), T149 (= T257), P186 (= P294), S215 (= S323), R216 (= R324), R225 (= R333), Y227 (= Y335), Q229 (= Q337), G254 (= G362), L255 (= L363), Y295 (= Y403)
2vzlA Ferredoxin-NADP reductase (mutations: t155g, a160t, l263p and y303s) complexed with NAD by cocrystallization (see paper)
75% identity, 73% coverage: 110:402/403 of query aligns to 1:294/295 of 2vzlA
- active site: Y71 (= Y180), S72 (= S181), C253 (= C361), E293 (= E401)
- binding flavin-adenine dinucleotide: R69 (= R178), L70 (= L179), Y71 (= Y180), S72 (= S181), C90 (= C199), L94 (= L203), Y96 (= Y205), G107 (= G215), V108 (= V216), C109 (= C217), S110 (= S218), T149 (= T257), E293 (= E401)
- binding nicotinamide-adenine-dinucleotide: S72 (= S181), R92 (= R201), T149 (= T257), C253 (= C361), G254 (= G362), P255 (≠ L363), E293 (= E401)
Sites not aligning to the query:
2b5oA Ferredoxin-NADP reductase
65% identity, 73% coverage: 111:403/403 of query aligns to 2:292/292 of 2b5oA
- active site: Y71 (= Y180), S72 (= S181), C250 (= C361), E290 (= E401), Y292 (= Y403)
- binding flavin-adenine dinucleotide: R69 (= R178), L70 (= L179), Y71 (= Y180), S72 (= S181), C90 (= C199), Y96 (= Y205), G107 (= G215), V108 (= V216), C109 (= C217), S110 (= S218), T150 (= T257), E290 (= E401), Y292 (= Y403)
P00455 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Spinacia oleracea (Spinach) (see 3 papers)
53% identity, 81% coverage: 78:403/403 of query aligns to 45:369/369 of P00455
- RLYS 148:151 (= RLYS 178:181) binding
- CVK 169:171 (≠ CVR 199:201) binding
- Y175 (= Y205) binding
- VCS 186:188 (= VCS 216:218) binding
- T227 (= T257) binding
- E367 (= E401) mutation to A: Slightly reduced activity.; mutation E->D,Q: Reduced activity.; mutation to L: Reduces activity by 99%.
Sites not aligning to the query:
- 1:55 modified: transit peptide, Chloroplast
P10933 Ferredoxin--NADP reductase, leaf isozyme, chloroplastic; FNR; EC 1.18.1.2 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see 2 papers)
56% identity, 77% coverage: 94:403/403 of query aligns to 52:360/360 of P10933
- RLYS 139:142 (= RLYS 178:181) binding
- S142 (= S181) binding
- CVK 160:162 (≠ CVR 199:201) binding
- K162 (≠ R201) binding
- Y166 (= Y205) binding
- VCS 177:179 (= VCS 216:218) binding
- T218 (= T257) binding
- VP 250:251 (≠ IP 293:294) binding
- SR 280:281 (= SR 323:324) binding
- K290 (≠ R333) binding
- GL 319:320 (= GL 362:363) binding
- E358 (= E401) binding
- Y360 (= Y403) mutation to F: Results in a 2.0-fold reduction in kcat for the diaphorase reaction.; mutation to G: Results in a 302-fold reduction in kcat for the diaphorase reaction.; mutation to S: Results in a 22-fold reduction in kcat for the diaphorase reaction.; mutation to W: Results in a 2.2-fold reduction in kcat for the diaphorase reaction.
1qgaA Pea fnr y308w mutant in complex with NADP+ (see paper)
55% identity, 76% coverage: 96:403/403 of query aligns to 6:308/308 of 1qgaA
- active site: Y89 (= Y180), S90 (= S181), C266 (= C361), E306 (= E401), W308 (≠ Y403)
- binding flavin-adenine dinucleotide: R87 (= R178), L88 (= L179), Y89 (= Y180), S90 (= S181), C108 (= C199), L112 (= L203), Y114 (= Y205), G124 (= G215), V125 (= V216), C126 (= C217), S127 (= S218), T166 (= T257), W308 (≠ Y403)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S181), K110 (≠ R201), G165 (= G256), T166 (= T257), G167 (= G258), V198 (≠ I293), P199 (= P294), S228 (= S323), R229 (= R324), K238 (≠ R333), Y240 (= Y335), Q242 (= Q337), C266 (= C361), G267 (= G362), L268 (= L363), E306 (= E401), W308 (≠ Y403)
1qfzA Pea fnr y308s mutant in complex with NADPH (see paper)
55% identity, 76% coverage: 96:402/403 of query aligns to 6:307/308 of 1qfzA
- active site: Y89 (= Y180), S90 (= S181), C266 (= C361), E306 (= E401)
- binding flavin-adenine dinucleotide: R87 (= R178), L88 (= L179), Y89 (= Y180), S90 (= S181), C108 (= C199), K110 (≠ R201), L112 (= L203), Y114 (= Y205), G124 (= G215), V125 (= V216), C126 (= C217), S127 (= S218), T166 (= T257)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S90 (= S181), K110 (≠ R201), G165 (= G256), T166 (= T257), G167 (= G258), V198 (≠ I293), P199 (= P294), S228 (= S323), R229 (= R324), Y240 (= Y335), C266 (= C361), G267 (= G362), L268 (= L363), G270 (= G365), E306 (= E401)
Sites not aligning to the query:
1qfyA Pea fnr y308s mutant in complex with NADP+ (see paper)
55% identity, 76% coverage: 96:402/403 of query aligns to 6:307/308 of 1qfyA
- active site: Y89 (= Y180), S90 (= S181), C266 (= C361), E306 (= E401)
- binding flavin-adenine dinucleotide: R87 (= R178), L88 (= L179), Y89 (= Y180), S90 (= S181), C108 (= C199), L112 (= L203), Y114 (= Y205), G124 (= G215), V125 (= V216), C126 (= C217), S127 (= S218), T166 (= T257)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S181), K110 (≠ R201), G165 (= G256), T166 (= T257), G167 (= G258), V198 (≠ I293), P199 (= P294), S228 (= S323), R229 (= R324), K238 (≠ R333), Y240 (= Y335), Q242 (= Q337), C266 (= C361), G267 (= G362), L268 (= L363), G270 (= G365), M271 (= M366), E306 (= E401)
Sites not aligning to the query:
3mhpA Fnr-recruitment to the thylakoid (see paper)
56% identity, 74% coverage: 105:403/403 of query aligns to 2:295/296 of 3mhpA
- active site: Y76 (= Y180), S77 (= S181), C253 (= C361), E293 (= E401), Y295 (= Y403)
- binding flavin-adenine dinucleotide: R74 (= R178), L75 (= L179), Y76 (= Y180), S77 (= S181), C95 (= C199), L99 (= L203), G111 (= G215), V112 (= V216), C113 (= C217), S114 (= S218), T153 (= T257), E293 (= E401), Y295 (= Y403)
- binding : L25 (≠ S128), T27 (≠ E130), K28 (≠ P131), I29 (≠ L132), H40 (= H143), F86 (≠ H190), G87 (≠ V191), W163 (= W267), F167 (≠ K271), E168 (≠ D272), K169 (≠ N273), E171 (≠ S279), S188 (≠ T296), S189 (≠ A297), E195 (= E303), E196 (= E304), K199 (≠ A307), K203 (≠ Q311)
3vo2A Crystal structure of zea mays leaf ferredoxin-NADP+ reductase iii (see paper)
56% identity, 74% coverage: 105:403/403 of query aligns to 3:296/296 of 3vo2A
- active site: Y77 (= Y180), S78 (= S181), C254 (= C361), E294 (= E401), Y296 (= Y403)
- binding flavin-adenine dinucleotide: R75 (= R178), L76 (= L179), Y77 (= Y180), S78 (= S181), C96 (= C199), V97 (= V200), L100 (= L203), Y102 (= Y205), G112 (= G215), V113 (= V216), C114 (= C217), S115 (= S218), T154 (= T257), E294 (= E401), Y296 (= Y403)
1gawB Crystal structure analysis of the ferredoxin-NADP+ reductase from maize leaf (see paper)
53% identity, 76% coverage: 96:403/403 of query aligns to 1:305/305 of 1gawB
- active site: Y86 (= Y180), S87 (= S181), C263 (= C361), E303 (= E401), Y305 (= Y403)
- binding flavin-adenine dinucleotide: R84 (= R178), L85 (= L179), Y86 (= Y180), S87 (= S181), C105 (= C199), Y111 (= Y205), G121 (= G215), V122 (= V216), C123 (= C217), S124 (= S218), T163 (= T257), Y305 (= Y403)
1fncA Refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states (see paper)
55% identity, 74% coverage: 105:403/403 of query aligns to 3:296/296 of 1fncA
- active site: Y77 (= Y180), S78 (= S181), C254 (= C361), E294 (= E401), Y296 (= Y403)
- binding adenosine-2'-5'-diphosphate: K98 (≠ R201), V186 (≠ I293), P187 (= P294), S216 (= S323), R217 (= R324), K226 (≠ R333), Y228 (= Y335), L256 (= L363), G258 (= G365)
- binding dihydroflavine-adenine dinucleotide: R75 (= R178), L76 (= L179), Y77 (= Y180), S78 (= S181), C96 (= C199), L100 (= L203), Y102 (= Y205), G112 (= G215), V113 (= V216), C114 (= C217), S115 (= S218), T154 (= T257), E294 (= E401), Y296 (= Y403)
1bx0A Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l (see paper)
55% identity, 74% coverage: 105:403/403 of query aligns to 3:296/296 of 1bx0A
- active site: Y77 (= Y180), S78 (= S181), C254 (= C361), L294 (≠ E401), Y296 (= Y403)
- binding flavin-adenine dinucleotide: R75 (= R178), L76 (= L179), Y77 (= Y180), S78 (= S181), C96 (= C199), Y102 (= Y205), G112 (= G215), V113 (= V216), C114 (= C217), S115 (= S218), T154 (= T257), Y296 (= Y403)
5h59A Ferredoxin-NADP+ reductase from maize root (see paper)
47% identity, 74% coverage: 107:403/403 of query aligns to 14:311/311 of 5h59A
- active site: Y88 (= Y180), S89 (= S181), F268 (≠ I360), C269 (= C361), E309 (= E401), Y311 (= Y403)
- binding flavin-adenine dinucleotide: R86 (= R178), L87 (= L179), Y88 (= Y180), S89 (= S181), C107 (= C199), Y113 (≠ Q204), K125 (≠ I213), G127 (= G215), V128 (= V216), C129 (= C217), S130 (= S218), T170 (= T257), Y311 (= Y403)
5vw4A Nicotinamide soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
47% identity, 73% coverage: 107:402/403 of query aligns to 12:308/309 of 5vw4A
- active site: Y86 (= Y180), S87 (= S181), F266 (≠ I360), C267 (= C361), E307 (= E401)
- binding flavin-adenine dinucleotide: R84 (= R178), L85 (= L179), Y86 (= Y180), S87 (= S181), C105 (= C199), A109 (vs. gap), Y111 (≠ Q204), K123 (≠ I213), G125 (= G215), V126 (= V216), C127 (= C217), S128 (= S218), T168 (= T257)
- binding nicotinamide: S87 (= S181), T168 (= T257), G169 (= G258), C267 (= C361), G268 (= G362), E307 (= E401), V308 (≠ T402)
Sites not aligning to the query:
5vw2A NADPH soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
47% identity, 73% coverage: 107:402/403 of query aligns to 12:308/309 of 5vw2A
- active site: Y86 (= Y180), S87 (= S181), F266 (≠ I360), C267 (= C361), E307 (= E401)
- binding dihydroflavine-adenine dinucleotide: R84 (= R178), L85 (= L179), Y86 (= Y180), S87 (= S181), C105 (= C199), A109 (vs. gap), Y111 (≠ Q204), K123 (≠ I213), G125 (= G215), V126 (= V216), C127 (= C217), S128 (= S218), T168 (= T257)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S87 (= S181), R107 (= R201), T166 (= T255), G167 (= G256), T168 (= T257), G169 (= G258), G199 (= G292), V200 (≠ I293), A201 (≠ P294), S230 (= S323), R231 (= R324), K240 (≠ R333), Y242 (= Y335), Q244 (= Q337), G268 (= G362), L269 (= L363), G271 (= G365), M272 (= M366), E307 (= E401), V308 (≠ T402)
Sites not aligning to the query:
P53991 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Chlamydomonas reinhardtii (Chlamydomonas smithii)
40% identity, 89% coverage: 47:403/403 of query aligns to 4:354/354 of P53991
- K118 (vs. gap) modified: N6,N6,N6-trimethyllysine
- K124 (= K173) modified: N6,N6,N6-trimethyllysine
- K170 (≠ N214) modified: N6,N6-dimethyllysine
Sites not aligning to the query:
- 1:35 modified: transit peptide, Chloroplast
2rc6A Refined structure of fnr from leptospira interrogans bound to NADP+ (see paper)
32% identity, 72% coverage: 113:403/403 of query aligns to 7:306/306 of 2rc6A
- active site: Y90 (= Y180), S91 (= S181), C264 (= C361), E304 (= E401), Y306 (= Y403)
- binding flavin-adenine dinucleotide: R88 (= R178), L89 (= L179), Y90 (= Y180), S91 (= S181), I109 (≠ C199), I110 (≠ V200), D113 (≠ L203), I115 (≠ Y205), F122 (≠ I213), G124 (= G215), V125 (= V216), C126 (= C217), S127 (= S218), T167 (= T257), E304 (= E401), Y306 (= Y403)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K111 (≠ R201), T165 (= T255), G166 (= G256), A197 (≠ I293), P198 (= P294), S226 (= S323), R227 (= R324), R237 (= R333), Y239 (= Y335), P267 (≠ L363), M270 (= M366)
- binding zinc ion: E181 (≠ K271), H216 (≠ Y312)
Query Sequence
>Synpcc7942_0978 FitnessBrowser__SynE:Synpcc7942_0978
MLNASVAGGAATTTYGNRLFIYEVIGLRQAEGEPSDSSIRRSGSTFFKVPYSRMNQEMQR
ILRLGGKIVSIRPAEEAAANNGAAPLQAAAEEPAAAPTPAPAAKKHSAEDVPVNIYRPNK
PFVGKVLSNEPLVQEGGIGVVQHLTFDISEGDLRYIEGQSIGIIPDGTDDKGKPHKLRLY
SIASTRHGDHVDDKTVSLCVRQLQYQNEAGETINGVCSTFLCGLKPGDDVKITGPVGKEM
LLPADTDANVIMMGTGTGIAPFRAYLWRMFKDNERAINSEYQFNGKAWLIFGIPTTANIL
YKEELEALQAQYPDNFRLTYAISREQKNEAGGRMYIQDRVAEHADEIWNLLKDEKTHVYI
CGLRGMEDGIDQAMTVAAAKEDVVWSDYQRTLKKAGRWHVETY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory