Comparing Synpcc7942_1007 FitnessBrowser__SynE:Synpcc7942_1007 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7c18B Crystal structure of fumarasec from mannheimia succiniciproducens in complex with fumarate
58% identity, 98% coverage: 8:463/463 of query aligns to 4:460/464 of 7c18B
P08417 Fumarate hydratase, mitochondrial; Fumarase; EC 4.2.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
58% identity, 98% coverage: 8:463/463 of query aligns to 29:485/488 of P08417
Sites not aligning to the query:
7lubB Crystal structure of recombinant human fumarase in complex with d-2- amino-3-phosphono-propionic acid (see paper)
59% identity, 98% coverage: 8:463/463 of query aligns to 3:459/462 of 7lubB
P07954 Fumarate hydratase, mitochondrial; Fumarase; HsFH; EC 4.2.1.2 from Homo sapiens (Human) (see 4 papers)
59% identity, 98% coverage: 8:463/463 of query aligns to 51:507/510 of P07954
Sites not aligning to the query:
P05042 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Escherichia coli (strain K12) (see 4 papers)
58% identity, 98% coverage: 8:463/463 of query aligns to 5:460/467 of P05042
1fupA Fumarase with bound pyromellitic acid (see paper)
58% identity, 98% coverage: 8:462/463 of query aligns to 1:455/455 of 1fupA
1fuqA Fumarase with bound 3-trimethylsilylsuccinic acid (see paper)
58% identity, 98% coverage: 8:462/463 of query aligns to 2:456/456 of 1fuqA
1fuoA FumarasE C with bound citrate (see paper)
58% identity, 98% coverage: 8:462/463 of query aligns to 2:456/456 of 1fuoA
Q9ZCQ4 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Rickettsia prowazekii (strain Madrid E) (see paper)
55% identity, 99% coverage: 6:463/463 of query aligns to 3:460/461 of Q9ZCQ4
P9WN93 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
49% identity, 98% coverage: 3:458/463 of query aligns to 6:459/474 of P9WN93
4adlA Crystal structures of rv1098c in complex with malate (see paper)
49% identity, 98% coverage: 6:458/463 of query aligns to 1:451/459 of 4adlA
4apbD Crystal structure of mycobacterium tuberculosis fumarase (rv1098c) s318c in complex with fumarate (see paper)
49% identity, 98% coverage: 6:458/463 of query aligns to 1:451/462 of 4apbD
3r6qA A triclinic-lattice structure of aspartase from bacillus sp. Ym55-1 (see paper)
41% identity, 98% coverage: 8:463/463 of query aligns to 2:456/462 of 3r6qA
3r6vG Crystal structure of aspartase from bacillus sp. Ym55-1 with bound l- aspartate (see paper)
41% identity, 98% coverage: 8:463/463 of query aligns to 3:457/463 of 3r6vG
6s88A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-((1,2,4,5-tetrahydro- 3h-benzo[d]azepin-3-yl)sulfonyl)phenyl)-2-(4-oxo-3,4- dihydrophthalazin-1-yl)acetamide (see paper)
48% identity, 97% coverage: 8:458/463 of query aligns to 2:442/450 of 6s88A
6s7wA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(quinolin-4-yl)acetamide (see paper)
48% identity, 97% coverage: 8:458/463 of query aligns to 2:442/450 of 6s7wA
6s7sA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-(n-phenylsulfamoyl) phenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
48% identity, 97% coverage: 8:458/463 of query aligns to 2:442/450 of 6s7sA
6s7uA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(1h-indol-3-yl)acetamide (see paper)
48% identity, 97% coverage: 8:458/463 of query aligns to 2:442/450 of 6s7uA
6s7kA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-(n-methylsulfamoyl) phenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
48% identity, 97% coverage: 8:458/463 of query aligns to 2:442/450 of 6s7kA
6s43A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azocan-1-ylsulfonyl)-2- methoxyphenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
48% identity, 97% coverage: 8:458/463 of query aligns to 2:442/450 of 6s43A
>Synpcc7942_1007 FitnessBrowser__SynE:Synpcc7942_1007
MTETANQRRESDSMGEVLVPTDRYWGAQTQRSLHYFSIGQDRMPIEVCHALAIAKKASAL
ANRDLGVLSAEKADLIAQAADEIIAGQLDDHFPLYVWMTGSGTQANMNVNEVIANRAIEM
AGGVLGSKTPIHPNDDVNRSQSSNDVFPTAMHIAAAQAIGRQLLPSIERLEQSLQAKVDE
WQGIVKIGRTHLQDAVPLTLGQEFSGFVAMLAENRQRLHNALQELYPLALGGTAVGTGLN
APTGFDVAVADYIAQLTGLPFVTATNKFAQIGAHDAFVALSGSLRGLAVSLYKIANDIRL
LACGPRCGFNELSLPANEPGSSIMPGKVNPTQCEALAMVAVQVMGYDAAVAFAGASGYLE
LNVYKPLMVYNVLESIRILSDASDNFRRFTVEGMTANTDQINTYLERSLMLVTALTPAIG
YDQAAKVAKYAFEKNLSLKEACLELGCISSEEFDRWVDPAQLV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory