SitesBLAST
Comparing Synpcc7942_1029 FitnessBrowser__SynE:Synpcc7942_1029 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
38% identity, 96% coverage: 9:301/304 of query aligns to 10:300/301 of 6thqB
- active site: F37 (= F36), K156 (= K156), E190 (= E190), L214 (= L214)
- binding pyridoxal-5'-phosphate: R60 (= R62), K156 (= K156), Y161 (= Y161), E190 (= E190), N195 (= N195), L214 (= L214), G216 (= G216), I217 (= I217), T218 (= T218), T254 (= T254)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R62), Y97 (= Y97), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), E194 (≠ M194), N195 (= N195), G216 (= G216), I217 (= I217), T218 (= T218), G253 (= G253), T254 (= T254), A255 (= A255)
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
39% identity, 95% coverage: 9:298/304 of query aligns to 8:301/305 of 2ej0B
- active site: F35 (= F36), G37 (= G38), K158 (= K156), E192 (= E190), L215 (= L214)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R62), Y163 (= Y161), E192 (= E190), G195 (= G193), E196 (≠ M194), L215 (= L214), G217 (= G216), I218 (= I217), T219 (= T218), G254 (= G253), T255 (= T254)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
35% identity, 96% coverage: 7:298/304 of query aligns to 4:300/304 of 1iyeA
- active site: F33 (= F36), G35 (= G38), K156 (= K156), A157 (≠ I157), E190 (= E190), L214 (= L214)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R62), Y92 (= Y97), Y126 (= Y130), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), E194 (≠ M194), N195 (= N195), L214 (= L214), G216 (= G216), I217 (= I217), T218 (= T218), G253 (= G253), T254 (= T254), A255 (= A255)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
35% identity, 96% coverage: 7:298/304 of query aligns to 4:300/304 of 1iydA
- active site: F33 (= F36), G35 (= G38), K156 (= K156), A157 (≠ I157), E190 (= E190), L214 (= L214)
- binding glutaric acid: Y92 (= Y97), Y126 (= Y130), A255 (= A255)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), E194 (≠ M194), L214 (= L214), G216 (= G216), I217 (= I217), T218 (= T218), T254 (= T254)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
35% identity, 96% coverage: 7:298/304 of query aligns to 4:300/304 of 1i1mA
- active site: K156 (= K156)
- binding 4-methyl valeric acid: Y92 (= Y97), K156 (= K156), T254 (= T254), A255 (= A255)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), E194 (≠ M194), L214 (= L214), G216 (= G216), I217 (= I217), T218 (= T218), G253 (= G253), T254 (= T254)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
35% identity, 96% coverage: 7:298/304 of query aligns to 4:300/304 of 1i1lA
- active site: K156 (= K156)
- binding 2-methylleucine: Y92 (= Y97), K156 (= K156), T254 (= T254), A255 (= A255)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), G216 (= G216), I217 (= I217), T218 (= T218), T254 (= T254)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
38% identity, 95% coverage: 9:298/304 of query aligns to 8:290/294 of 2ej2A
- active site: F35 (= F36), G37 (= G38), K147 (= K156), E181 (= E190), L204 (= L214)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R62), Y94 (= Y97), Y152 (= Y161), E181 (= E190), G184 (= G193), E185 (≠ M194), L204 (= L214), G206 (= G216), I207 (= I217), T208 (= T218), T244 (= T254), A245 (= A255)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
38% identity, 95% coverage: 9:298/304 of query aligns to 8:293/297 of 2ej3A
- active site: F35 (= F36), G37 (= G38), K150 (= K156), E184 (= E190), L207 (= L214)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (= G193), G246 (= G253), T247 (= T254), A248 (= A255)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K156), Y155 (= Y161), E184 (= E190), G187 (= G193), L207 (= L214), G209 (= G216), I210 (= I217), T211 (= T218), G246 (= G253), T247 (= T254)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
38% identity, 95% coverage: 9:298/304 of query aligns to 8:293/297 of 2eiyA
- active site: F35 (= F36), G37 (= G38), K150 (= K156), E184 (= E190), L207 (= L214)
- binding 4-methyl valeric acid: F35 (= F36), Y94 (= Y97), T247 (= T254), A248 (= A255)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K156), Y155 (= Y161), E184 (= E190), G187 (= G193), E188 (≠ M194), L207 (= L214), G209 (= G216), I210 (= I217), T211 (= T218), G246 (= G253), T247 (= T254)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
38% identity, 95% coverage: 9:298/304 of query aligns to 8:293/297 of 1wrvA
- active site: F35 (= F36), G37 (= G38), K150 (= K156), E184 (= E190), L207 (= L214)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K156), Y155 (= Y161), E184 (= E190), G187 (= G193), L207 (= L214), G209 (= G216), I210 (= I217), T211 (= T218), T247 (= T254)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
33% identity, 96% coverage: 9:301/304 of query aligns to 10:306/306 of 4whxA
6h65C Crystal structure of the branched-chain-amino-acid aminotransferase from haliangium ochraceum
34% identity, 97% coverage: 7:301/304 of query aligns to 6:306/308 of 6h65C
- active site: F35 (= F36), K158 (= K156), E192 (= E190), L216 (= L214)
- binding pyridoxal-5'-phosphate: R60 (= R62), K158 (= K156), Y163 (= Y161), E192 (= E190), A196 (≠ M194), L216 (= L214), S218 (≠ G216), V219 (≠ I217), T220 (= T218), G256 (= G253), T257 (= T254)
6q8eA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in pmp-form (see paper)
33% identity, 98% coverage: 7:303/304 of query aligns to 5:306/307 of 6q8eA
- active site: F34 (= F36), K156 (= K156), E190 (= E190), L214 (= L214)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R59 (= R62), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), S194 (≠ M194), C195 (≠ N195), L214 (= L214), S216 (≠ G216), I217 (= I217), T218 (= T218), G254 (= G253), T255 (= T254)
7neaA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum (m3 mutant). (see paper)
32% identity, 98% coverage: 7:303/304 of query aligns to 5:306/309 of 7neaA
- active site: F34 (= F36), K156 (= K156), E190 (= E190), L214 (= L214)
- binding pyridoxal-5'-phosphate: R59 (= R62), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), S194 (≠ M194), L214 (= L214), S216 (≠ G216), I217 (= I217), T218 (= T218), T255 (= T254)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
35% identity, 93% coverage: 7:288/304 of query aligns to 3:282/290 of 5mr0D
- active site: F32 (= F36), G34 (= G38), K150 (= K156), E183 (= E190), L206 (= L214)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R62), G100 (= G108), L101 (≠ I109), K150 (= K156), Y154 (= Y161), E183 (= E190), G186 (= G193), D187 (≠ M194), L206 (= L214), I209 (= I217), T210 (= T218), G245 (= G253), T246 (= T254)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
33% identity, 92% coverage: 8:288/304 of query aligns to 5:283/290 of 5e25A
- active site: F33 (= F36), G35 (= G38), K151 (= K156), E184 (= E190), L207 (= L214)
- binding 2-oxoglutaric acid: Y88 (= Y97), K151 (= K156), T247 (= T254), A248 (= A255)
- binding pyridoxal-5'-phosphate: R52 (= R62), K151 (= K156), Y155 (= Y161), E184 (= E190), G187 (= G193), D188 (≠ M194), L207 (= L214), G209 (= G216), I210 (= I217), T211 (= T218), G246 (= G253), T247 (= T254)
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
31% identity, 96% coverage: 8:298/304 of query aligns to 49:364/368 of A0R066
- R101 (= R62) binding
- Y209 (= Y161) binding
- K299 (vs. gap) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T254) binding
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
29% identity, 97% coverage: 5:298/304 of query aligns to 9:331/335 of 3ht5A
- active site: K171 (= K156)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R62), K171 (= K156), Y176 (= Y161), E207 (= E190), G210 (= G193), M211 (= M194), N212 (= N195), L235 (= L214), G237 (= G216), I238 (= I217), T239 (= T218), T281 (= T254)
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
31% identity, 96% coverage: 8:298/304 of query aligns to 44:359/363 of 3dtgA
- active site: K199 (= K156)
- binding O-benzylhydroxylamine: F72 (= F36), Y171 (= Y130), Y204 (= Y161)
- binding pyridoxal-5'-phosphate: R96 (= R62), R189 (≠ Q146), K199 (= K156), Y204 (= Y161), E235 (= E190), G238 (= G193), L263 (= L214), I266 (= I217), T267 (= T218), T309 (= T254)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
31% identity, 96% coverage: 8:298/304 of query aligns to 44:359/363 of 3dtfA
Query Sequence
>Synpcc7942_1029 FitnessBrowser__SynE:Synpcc7942_1029
MNDFLPYAFFRGQLVPFPEAQLSIATHALHYGTGAFGGLRGIPDPENPDRVLLFRLDRHC
QRLSQSAKFLHFELSAEEIFKAIEAFVQKNQPSQSFYIRPFVYTSDLGIAPRLHNIEKDF
FIYGLQLGDYLSPEGVSCRISSWYRQEDRSLPLRGKISGAYIASSLAKTEAVASGFDEAI
LMNSQGKVCEATGMNLFMVRNGRLITPGYDQDILEGITRDSVIRVAQDLGIPVDQRPIDK
SELFIADEVFLSGTAAKVTPVKQVENYLTPCDRPITDQIRQQLTLITEGRLAAYQDWVFP
IALR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory